BLASTX nr result
ID: Ophiopogon21_contig00024006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00024006 (513 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048776.1| Uncharacterized protein TCM_001795 [Theobrom... 68 3e-09 emb|CDP04553.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CBI41065.3| unnamed protein product [Vitis vinifera] 59 1e-06 gb|KHN40769.1| hypothetical protein glysoja_015136 [Glycine soja] 57 7e-06 >ref|XP_007048776.1| Uncharacterized protein TCM_001795 [Theobroma cacao] gi|508701037|gb|EOX92933.1| Uncharacterized protein TCM_001795 [Theobroma cacao] Length = 69 Score = 67.8 bits (164), Expect = 3e-09 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -2 Query: 359 RLEAMEHEIHPRGCRCCWFILTPLIQCGKLCCGNDCC 249 RLE+ E HP+GCRCC+FI P+I+CGK+CCG+DCC Sbjct: 32 RLESFEQGFHPQGCRCCFFIWKPMIRCGKVCCGDDCC 68 >emb|CDP04553.1| unnamed protein product [Coffea canephora] Length = 65 Score = 59.3 bits (142), Expect = 1e-06 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = -2 Query: 359 RLEAMEHEIHPRGCRCCWFILTPLIQCGKLCCGNDCC 249 RL+ E +HP+GCRCC F PLI+C ++CCG+DCC Sbjct: 29 RLQTSEQTVHPQGCRCCTFEWQPLIRCIRVCCGDDCC 65 >emb|CBI41065.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -2 Query: 353 EAMEHEIHPR-GCRCCWFILTPLIQCGKLCCGNDCC 249 +A+E +HP+ GCRCCWFI P I CGK CCG+ CC Sbjct: 30 QAVEDMVHPQAGCRCCWFIWKPRISCGKACCGDGCC 65 >gb|KHN40769.1| hypothetical protein glysoja_015136 [Glycine soja] Length = 32 Score = 56.6 bits (135), Expect = 7e-06 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = -2 Query: 332 HPRGCRCCWFILTPLIQCGKLCCGNDCC 249 +P+GCRCCWFI P+I+CGK+CC + CC Sbjct: 4 YPQGCRCCWFIWKPMIKCGKVCCEDGCC 31