BLASTX nr result
ID: Ophiopogon21_contig00023061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00023061 (741 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494... 67 4e-11 >ref|XP_012575066.1| PREDICTED: uncharacterized protein LOC101494761 [Cicer arietinum] Length = 420 Score = 67.4 bits (163), Expect(2) = 4e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 612 PPPQAEFVSRVIGDHFARFGGHVE*AAGARLRLYPYPIFGPIP 740 P PQAE VS VIGDHFARFG +E AAG+RLRL PYPIFGPIP Sbjct: 54 PTPQAELVSGVIGDHFARFGA-LESAAGSRLRLDPYPIFGPIP 95 Score = 28.1 bits (61), Expect(2) = 4e-11 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 584 APYRRRIIGTPTP 622 AP RRRIIGTPTP Sbjct: 44 APDRRRIIGTPTP 56