BLASTX nr result
ID: Ophiopogon21_contig00023006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00023006 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79317.1| hypothetical protein VITISV_008344 [Vitis vinifera] 57 5e-06 >emb|CAN79317.1| hypothetical protein VITISV_008344 [Vitis vinifera] Length = 118 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +3 Query: 219 YVVFVGRRPGVYSNWPECEAQVSGYKKALYKRYNTYE 329 YVVF GR+ G+Y++WPEC+ QV GYK +YK Y T+E Sbjct: 32 YVVFAGRKKGIYNSWPECQEQVVGYKGNVYKLYKTFE 68