BLASTX nr result
ID: Ophiopogon21_contig00022056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00022056 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009403544.1| PREDICTED: pre-mRNA-splicing factor 38B-like... 57 5e-06 >ref|XP_009403544.1| PREDICTED: pre-mRNA-splicing factor 38B-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 459 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 284 LSTILYKYYFDTLFPRIPVPIMRQITANLER 376 LSTI +KYYFDTLFPR+PVP++RQI ANLE+ Sbjct: 180 LSTIKFKYYFDTLFPRVPVPVVRQIVANLEK 210