BLASTX nr result
ID: Ophiopogon21_contig00021167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00021167 (569 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012764350.1| conserved Plasmodium protein, unknown functi... 61 4e-07 ref|XP_012762108.1| SET domain protein, putative [Plasmodium rei... 59 2e-06 >ref|XP_012764350.1| conserved Plasmodium protein, unknown function [Plasmodium reichenowi] gi|641580426|emb|CDO65763.1| conserved Plasmodium protein, unknown function [Plasmodium reichenowi] Length = 412 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/94 (32%), Positives = 46/94 (48%) Frame = -1 Query: 389 NENENSPNGDKDGGLKVNQSPPKNDEKKNGDKQRGKNGPSKNPENPKKHDEPNGGDGPAK 210 NEN+N N + G N+E KNGD KNG + +N ++ NG + K Sbjct: 233 NENKNGDNNENKNGDNNENKNGDNNENKNGDNNENKNGDNNENKNGDNNENKNGDNNENK 292 Query: 209 SQENMKKDDERKEGEGPPTSEENGKKNDEKQGGN 108 + +N K DDE K + T+ +N N+EK+ N Sbjct: 293 NGDNNKNDDENKNDQTSKTNSQN--DNEEKKSEN 324 >ref|XP_012762108.1| SET domain protein, putative [Plasmodium reichenowi] gi|641582724|emb|CDO63481.1| SET domain protein, putative [Plasmodium reichenowi] Length = 6773 Score = 58.9 bits (141), Expect = 2e-06 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 1/99 (1%) Frame = -1 Query: 386 ENENSPNGDKDGGLKVNQSPPKNDEKKNGDKQRGKNGPSKNPENPKKHDEPNGGDGPAKS 207 + EN N +K + N KNDE+K D+++ +G KN E KK+D+ D K Sbjct: 4319 DTENDENKEKGIKKEKNDEEKKNDEEKKNDEEKKNDGEKKNDEE-KKNDDEKKNDDEKKK 4377 Query: 206 QENMKKDDERKEGEGPPTSEE-NGKKNDEKQGGNVPNIE 93 E KKD+E+K+ E +E N KK E + G +++ Sbjct: 4378 DEEKKKDEEKKKDEEKKKDDEKNEKKKKENKKGREKSVK 4416