BLASTX nr result
ID: Ophiopogon21_contig00020791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00020791 (343 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010929296.1| PREDICTED: general transcription factor 3C p... 74 4e-11 ref|XP_010929295.1| PREDICTED: general transcription factor 3C p... 74 4e-11 ref|XP_008799435.1| PREDICTED: transcription factor tau subunit ... 74 4e-11 ref|XP_008799434.1| PREDICTED: transcription factor tau subunit ... 74 4e-11 ref|XP_012575688.1| PREDICTED: general transcription factor 3C p... 69 2e-09 ref|XP_009380749.1| PREDICTED: general transcription factor 3C p... 68 2e-09 ref|XP_009380748.1| PREDICTED: general transcription factor 3C p... 68 2e-09 ref|XP_009380747.1| PREDICTED: general transcription factor 3C p... 68 2e-09 ref|XP_010239742.1| PREDICTED: general transcription factor 3C p... 67 7e-09 ref|XP_013448798.1| general transcription factor 3C-like protein... 66 1e-08 ref|XP_003622989.2| general transcription factor 3C-like protein... 66 1e-08 ref|XP_003622988.2| general transcription factor 3C-like protein... 66 1e-08 ref|XP_010541506.1| PREDICTED: general transcription factor 3C p... 65 2e-08 ref|XP_010541504.1| PREDICTED: general transcription factor 3C p... 65 2e-08 dbj|BAJ90699.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 3e-08 gb|KOM45262.1| hypothetical protein LR48_Vigan06g056800 [Vigna a... 64 3e-08 ref|XP_010101333.1| hypothetical protein L484_020348 [Morus nota... 64 3e-08 gb|KMZ68078.1| General transcription factor 3C polypeptide [Zost... 64 4e-08 ref|XP_007157964.1| hypothetical protein PHAVU_002G1131001g, par... 63 8e-08 gb|KNA09115.1| hypothetical protein SOVF_156450 isoform B [Spina... 62 1e-07 >ref|XP_010929296.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X2 [Elaeis guineensis] Length = 587 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = -1 Query: 172 PSAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 P P+ + V+T+G SGVLP +E+F ++YPGYPSST RA++TLGGL EIAK RS Sbjct: 8 PPKPSTSSVVTDGAVSGVLPAAEAFSIHYPGYPSSTERAIETLGGLPEIAKVRS 61 >ref|XP_010929295.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Elaeis guineensis] Length = 591 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = -1 Query: 172 PSAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 P P+ + V+T+G SGVLP +E+F ++YPGYPSST RA++TLGGL EIAK RS Sbjct: 8 PPKPSTSSVVTDGAVSGVLPAAEAFSIHYPGYPSSTERAIETLGGLPEIAKVRS 61 >ref|XP_008799435.1| PREDICTED: transcription factor tau subunit sfc1-like isoform X2 [Phoenix dactylifera] Length = 582 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/53 (64%), Positives = 43/53 (81%) Frame = -1 Query: 169 SAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 S P+ + VI +G SGVLP +E+F ++YPGYPSST RA++TLGGL EIAKARS Sbjct: 9 SKPSTSSVIKDGTVSGVLPAAEAFAIHYPGYPSSTERAIETLGGLQEIAKARS 61 >ref|XP_008799434.1| PREDICTED: transcription factor tau subunit sfc1-like isoform X1 [Phoenix dactylifera] Length = 583 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/53 (64%), Positives = 43/53 (81%) Frame = -1 Query: 169 SAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 S P+ + VI +G SGVLP +E+F ++YPGYPSST RA++TLGGL EIAKARS Sbjct: 9 SKPSTSSVIKDGTVSGVLPAAEAFAIHYPGYPSSTERAIETLGGLQEIAKARS 61 >ref|XP_012575688.1| PREDICTED: general transcription factor 3C polypeptide 5-like [Cicer arietinum] Length = 562 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 VI +G SGVLP+ + F+V+YPGYPSSTSRAVDTLGG+ I KARS Sbjct: 3 VIKDGTISGVLPEPQGFLVHYPGYPSSTSRAVDTLGGIQGILKARS 48 >ref|XP_009380749.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 578 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = -1 Query: 172 PSAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 P + + VI +G SGVLP++ F V+YPGYPSST+RA++TLGGL EIAK RS Sbjct: 5 PGEASTSSVIRDGAVSGVLPETAVFAVHYPGYPSSTARAIETLGGLPEIAKVRS 58 >ref|XP_009380748.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 579 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = -1 Query: 172 PSAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 P + + VI +G SGVLP++ F V+YPGYPSST+RA++TLGGL EIAK RS Sbjct: 5 PGEASTSSVIRDGAVSGVLPETAVFAVHYPGYPSSTARAIETLGGLPEIAKVRS 58 >ref|XP_009380747.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 582 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = -1 Query: 172 PSAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 P + + VI +G SGVLP++ F V+YPGYPSST+RA++TLGGL EIAK RS Sbjct: 5 PGEASTSSVIRDGAVSGVLPETAVFAVHYPGYPSSTARAIETLGGLPEIAKVRS 58 >ref|XP_010239742.1| PREDICTED: general transcription factor 3C polypeptide 5-like [Brachypodium distachyon] gi|944046368|gb|KQJ82009.1| hypothetical protein BRADI_5g04838 [Brachypodium distachyon] Length = 553 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = -1 Query: 187 PAFAFPSAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 P A P +P+ +ITNG +G+LP +E+F V+YPGYPSS +RA TLGGL IAK RS Sbjct: 7 PTAAAPQSPS---IITNGAVNGLLPGAEAFAVHYPGYPSSPARAAHTLGGLPTIAKVRS 62 >ref|XP_013448798.1| general transcription factor 3C-like protein [Medicago truncatula] gi|657378002|gb|KEH22825.1| general transcription factor 3C-like protein [Medicago truncatula] Length = 522 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 VI +G SGVLP+ + F+V+YPGYPS+TSRAVDTLGG I KARS Sbjct: 3 VIKDGTISGVLPEPQGFLVHYPGYPSTTSRAVDTLGGSQGILKARS 48 >ref|XP_003622989.2| general transcription factor 3C-like protein [Medicago truncatula] gi|657378001|gb|AES79207.2| general transcription factor 3C-like protein [Medicago truncatula] Length = 561 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 VI +G SGVLP+ + F+V+YPGYPS+TSRAVDTLGG I KARS Sbjct: 3 VIKDGTISGVLPEPQGFLVHYPGYPSTTSRAVDTLGGSQGILKARS 48 >ref|XP_003622988.2| general transcription factor 3C-like protein [Medicago truncatula] gi|657378000|gb|AES79206.2| general transcription factor 3C-like protein [Medicago truncatula] Length = 584 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 VI +G SGVLP+ + F+V+YPGYPS+TSRAVDTLGG I KARS Sbjct: 3 VIKDGTISGVLPEPQGFLVHYPGYPSTTSRAVDTLGGSQGILKARS 48 >ref|XP_010541506.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X2 [Tarenaya hassleriana] Length = 569 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARSFGS 2 VI NG SG LP +E+F+V+YPGYPSS SRAVDTLGG+ I AR S Sbjct: 3 VIENGTISGTLPSTEAFVVHYPGYPSSISRAVDTLGGIEGIKMARGSAS 51 >ref|XP_010541504.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Tarenaya hassleriana] gi|729345243|ref|XP_010541505.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Tarenaya hassleriana] Length = 577 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARSFGS 2 VI NG SG LP +E+F+V+YPGYPSS SRAVDTLGG+ I AR S Sbjct: 3 VIENGTISGTLPSTEAFVVHYPGYPSSISRAVDTLGGIEGIKMARGSAS 51 >dbj|BAJ90699.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 561 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/59 (55%), Positives = 38/59 (64%) Frame = -1 Query: 187 PAFAFPSAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 P A +AP IT+G SG LP +E+F V YPGYPSS +RA TLGGL IAK RS Sbjct: 8 PTAASAAAPESPSTITDGAVSGTLPGTEAFAVYYPGYPSSPARATHTLGGLPAIAKVRS 66 >gb|KOM45262.1| hypothetical protein LR48_Vigan06g056800 [Vigna angularis] Length = 561 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 VI +G SGV+P+ E F+V+YP YPSS SRAVDTLGG+ I KARS Sbjct: 3 VIKDGTISGVIPEPEGFLVHYPAYPSSISRAVDTLGGIQGILKARS 48 >ref|XP_010101333.1| hypothetical protein L484_020348 [Morus notabilis] gi|587899909|gb|EXB88280.1| hypothetical protein L484_020348 [Morus notabilis] Length = 553 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/56 (57%), Positives = 38/56 (67%) Frame = -1 Query: 169 SAPNLAVVITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARSFGS 2 S + V+ +G SG +P E+F VNYPGYPSS SRAV+TLGGL I KARS S Sbjct: 18 SGRQMGVIKKDGRVSGFVPSKEAFAVNYPGYPSSISRAVETLGGLEAIHKARSLQS 73 >gb|KMZ68078.1| General transcription factor 3C polypeptide [Zostera marina] Length = 571 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 VI +G GV P++ESF V+YP YPSS SRAV+TLGG++EIAK RS Sbjct: 3 VIRDGTIVGVFPETESFAVHYPAYPSSLSRAVETLGGIDEIAKRRS 48 >ref|XP_007157964.1| hypothetical protein PHAVU_002G1131001g, partial [Phaseolus vulgaris] gi|561031379|gb|ESW29958.1| hypothetical protein PHAVU_002G1131001g, partial [Phaseolus vulgaris] Length = 220 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 VI +G SGV+P+ + F+V+YP YPSS SRAVDTLGG+ I KARS Sbjct: 3 VIKDGTISGVIPEPQGFLVHYPAYPSSISRAVDTLGGIQGILKARS 48 >gb|KNA09115.1| hypothetical protein SOVF_156450 isoform B [Spinacia oleracea] Length = 550 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -1 Query: 148 VITNGVASGVLPQSESFIVNYPGYPSSTSRAVDTLGGLNEIAKARS 11 VI +G A G LP E F V+YP YPSS SRAV+TLGG++ IAKARS Sbjct: 3 VIEDGTAKGCLPSEELFAVHYPAYPSSMSRAVETLGGIDAIAKARS 48