BLASTX nr result
ID: Ophiopogon21_contig00020682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00020682 (606 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO65382.1| hypothetical protein CISIN_1g026790mg [Citrus sin... 65 4e-08 ref|XP_009401919.1| PREDICTED: clp protease-related protein At4g... 64 5e-08 ref|XP_010109098.1| Clp protease-related protein [Morus notabili... 64 8e-08 ref|XP_002268037.2| PREDICTED: clp protease-related protein At4g... 64 8e-08 emb|CAN60931.1| hypothetical protein VITISV_006813 [Vitis vinifera] 64 8e-08 ref|XP_009354668.1| PREDICTED: clp protease-related protein At4g... 63 1e-07 ref|XP_008375118.1| PREDICTED: clp protease-related protein At4g... 63 1e-07 ref|XP_006490254.1| PREDICTED: clp protease-related protein At4g... 63 1e-07 ref|XP_006421758.1| hypothetical protein CICLE_v10005783mg [Citr... 63 1e-07 ref|XP_009382019.1| PREDICTED: clp protease-related protein At4g... 63 1e-07 ref|XP_009382018.1| PREDICTED: clp protease-related protein At4g... 63 1e-07 ref|XP_009382015.1| PREDICTED: clp protease-related protein At4g... 63 1e-07 ref|XP_009382014.1| PREDICTED: clp protease-related protein At4g... 63 1e-07 ref|XP_012090389.1| PREDICTED: clp protease-related protein At4g... 62 2e-07 ref|XP_009382017.1| PREDICTED: clp protease-related protein At4g... 62 2e-07 ref|XP_009382016.1| PREDICTED: clp protease-related protein At4g... 62 2e-07 ref|XP_010917990.1| PREDICTED: clp protease-related protein At4g... 62 3e-07 ref|XP_011041685.1| PREDICTED: clp protease-related protein At4g... 61 5e-07 ref|XP_011041684.1| PREDICTED: clp protease-related protein At4g... 61 5e-07 ref|XP_002321851.1| Clp amino terminal domain-containing family ... 61 5e-07 >gb|KDO65382.1| hypothetical protein CISIN_1g026790mg [Citrus sinensis] Length = 231 Score = 64.7 bits (156), Expect = 4e-08 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G+ GE+T++H+LLGI SEKESAG+KILA++GFN + A E+AKSVS Sbjct: 181 GESGEITTNHLLLGIWSEKESAGHKILATLGFNDEKAKEIAKSVS 225 >ref|XP_009401919.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 225 Score = 64.3 bits (155), Expect = 5e-08 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G+ GE+T++H+LLGI SEKESAGYKILAS+GF+ ASELAKS + Sbjct: 173 GEDGEITTAHMLLGIWSEKESAGYKILASLGFDDQKASELAKSAN 217 >ref|XP_010109098.1| Clp protease-related protein [Morus notabilis] gi|587933948|gb|EXC20898.1| Clp protease-related protein [Morus notabilis] Length = 257 Score = 63.5 bits (153), Expect = 8e-08 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKS 478 G+ GE+T++H+LLGI SEKESAG+KILAS+GFN + A ELAKS Sbjct: 186 GESGEITTAHLLLGIWSEKESAGHKILASLGFNDEKAKELAKS 228 >ref|XP_002268037.2| PREDICTED: clp protease-related protein At4g12060, chloroplastic [Vitis vinifera] gi|296084123|emb|CBI24511.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 63.5 bits (153), Expect = 8e-08 Identities = 29/45 (64%), Positives = 40/45 (88%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G+ GE+T+SH+LLGI +E+ESAG+KILA++GFN D A ELAKS++ Sbjct: 180 GEEGEITTSHLLLGIWAEEESAGHKILATLGFNDDQAKELAKSIN 224 >emb|CAN60931.1| hypothetical protein VITISV_006813 [Vitis vinifera] Length = 231 Score = 63.5 bits (153), Expect = 8e-08 Identities = 29/45 (64%), Positives = 40/45 (88%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G+ GE+T+SH+LLGI +E+ESAG+KILA++GFN D A ELAKS++ Sbjct: 180 GEEGEITTSHLLLGIWAEEESAGHKILATLGFNDDQAKELAKSIN 224 >ref|XP_009354668.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Pyrus x bretschneideri] Length = 239 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSV 475 G+ GE+T +H+LLGI SEKESAGYKILAS+GF+ D A+EL+KS+ Sbjct: 187 GENGEITVTHLLLGIWSEKESAGYKILASLGFDDDKATELSKSM 230 >ref|XP_008375118.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic [Malus domestica] Length = 239 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSV 475 G+ GE+T +H+LLGI SEKESAGYKILAS+GF+ D A+EL+KS+ Sbjct: 187 GENGEITVTHLLLGIWSEKESAGYKILASLGFDDDKATELSKSM 230 >ref|XP_006490254.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Citrus sinensis] gi|641846498|gb|KDO65381.1| hypothetical protein CISIN_1g026790mg [Citrus sinensis] Length = 233 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/45 (62%), Positives = 40/45 (88%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G+ GE+T++H+LLGI SEKESAG+KILA++GFN + A E+AKS++ Sbjct: 181 GESGEITTNHLLLGIWSEKESAGHKILATLGFNDEKAKEIAKSIN 225 >ref|XP_006421758.1| hypothetical protein CICLE_v10005783mg [Citrus clementina] gi|557523631|gb|ESR34998.1| hypothetical protein CICLE_v10005783mg [Citrus clementina] Length = 233 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/45 (62%), Positives = 40/45 (88%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G+ GE+T++H+LLGI SEKESAG+KILA++GFN + A E+AKS++ Sbjct: 181 GESGEITTNHLLLGIWSEKESAGHKILATLGFNDEKAKEIAKSIN 225 >ref|XP_009382019.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X6 [Musa acuminata subsp. malaccensis] Length = 235 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKS 478 G+ GE+T++H+LLGI SEKESAG+KILAS+GF+ + ASELAKS Sbjct: 183 GEDGEITTAHLLLGIWSEKESAGHKILASLGFDDEKASELAKS 225 >ref|XP_009382018.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X5 [Musa acuminata subsp. malaccensis] Length = 236 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKS 478 G+ GE+T++H+LLGI SEKESAG+KILAS+GF+ + ASELAKS Sbjct: 184 GEDGEITTAHLLLGIWSEKESAGHKILASLGFDDEKASELAKS 226 >ref|XP_009382015.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 244 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKS 478 G+ GE+T++H+LLGI SEKESAG+KILAS+GF+ + ASELAKS Sbjct: 192 GEDGEITTAHLLLGIWSEKESAGHKILASLGFDDEKASELAKS 234 >ref|XP_009382014.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 245 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKS 478 G+ GE+T++H+LLGI SEKESAG+KILAS+GF+ + ASELAKS Sbjct: 193 GEDGEITTAHLLLGIWSEKESAGHKILASLGFDDEKASELAKS 235 >ref|XP_012090389.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic [Jatropha curcas] gi|643706251|gb|KDP22383.1| hypothetical protein JCGZ_26214 [Jatropha curcas] Length = 227 Score = 62.4 bits (150), Expect = 2e-07 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G GE+T SH+LLGI SEKESAG+KILA++GFN + A E+AKS++ Sbjct: 175 GDEGEITPSHILLGIWSEKESAGHKILATLGFNDEKAKEIAKSMN 219 >ref|XP_009382017.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X4 [Musa acuminata subsp. malaccensis] Length = 239 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVSL 469 G+ GE+T++H+LLGI SEKESAG+KILAS+GF+ + ASELAK + + Sbjct: 192 GEDGEITTAHLLLGIWSEKESAGHKILASLGFDDEKASELAKLIRI 237 >ref|XP_009382016.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 240 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVSL 469 G+ GE+T++H+LLGI SEKESAG+KILAS+GF+ + ASELAK + + Sbjct: 193 GEDGEITTAHLLLGIWSEKESAGHKILASLGFDDEKASELAKLIRI 238 >ref|XP_010917990.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Elaeis guineensis] Length = 247 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G GE+T++H+LLGI SEK+SAG+KILAS+GF+ D A+ELAKS + Sbjct: 195 GDDGEITTTHMLLGIWSEKDSAGHKILASLGFDDDKANELAKSAN 239 >ref|XP_011041685.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X2 [Populus euphratica] Length = 119 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G GE+T++H+LLGI SEKESAG+ IL ++GFN D A E+AKS+S Sbjct: 67 GDSGEITTTHILLGIWSEKESAGHNILETLGFNDDKAKEVAKSMS 111 >ref|XP_011041684.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X1 [Populus euphratica] Length = 228 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G GE+T++H+LLGI SEKESAG+ IL ++GFN D A E+AKS+S Sbjct: 176 GDSGEITTTHILLGIWSEKESAGHNILETLGFNDDKAKEVAKSMS 220 >ref|XP_002321851.1| Clp amino terminal domain-containing family protein [Populus trichocarpa] gi|222868847|gb|EEF05978.1| Clp amino terminal domain-containing family protein [Populus trichocarpa] Length = 160 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 606 GKIGEVTSSHVLLGI*SEKESAGYKILASIGFNSDNASELAKSVS 472 G GE+T++H+LLGI SEKESAG+ IL ++GFN D A E+AKS+S Sbjct: 108 GDSGEITTTHILLGIWSEKESAGHNILETLGFNDDKAKEVAKSMS 152