BLASTX nr result
ID: Ophiopogon21_contig00020658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00020658 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010917047.1| PREDICTED: probable apyrase 6 isoform X2 [El... 56 9e-06 ref|XP_010917046.1| PREDICTED: probable apyrase 6 isoform X1 [El... 56 9e-06 >ref|XP_010917047.1| PREDICTED: probable apyrase 6 isoform X2 [Elaeis guineensis] Length = 493 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 108 VTFLSSDLSLLEFAHVLKFGEITYNLYSNSFLHLGQ 1 VTF+S++ EF HVLKFGE TYNLYSNSFLH GQ Sbjct: 220 VTFVSNEALPAEFLHVLKFGETTYNLYSNSFLHYGQ 255 >ref|XP_010917046.1| PREDICTED: probable apyrase 6 isoform X1 [Elaeis guineensis] Length = 517 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 108 VTFLSSDLSLLEFAHVLKFGEITYNLYSNSFLHLGQ 1 VTF+S++ EF HVLKFGE TYNLYSNSFLH GQ Sbjct: 220 VTFVSNEALPAEFLHVLKFGETTYNLYSNSFLHYGQ 255