BLASTX nr result
ID: Ophiopogon21_contig00020387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00020387 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09949.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_010053463.1| PREDICTED: leukocyte receptor cluster member... 57 5e-06 gb|KCW77767.1| hypothetical protein EUGRSUZ_D02068 [Eucalyptus g... 57 5e-06 gb|KCW77759.1| hypothetical protein EUGRSUZ_D02058 [Eucalyptus g... 57 5e-06 ref|XP_006355463.1| PREDICTED: leukocyte receptor cluster member... 56 9e-06 ref|XP_004246150.1| PREDICTED: leukocyte receptor cluster member... 56 9e-06 >emb|CDP09949.1| unnamed protein product [Coffea canephora] Length = 253 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 380 VITAEDEKYRLGYGLMGKGVKAPWYLSKPEG 288 V+TAEDEKYRLGYGL+GKG K PWY++KP G Sbjct: 134 VVTAEDEKYRLGYGLVGKGAKLPWYMAKPGG 164 >ref|XP_010053463.1| PREDICTED: leukocyte receptor cluster member 1 homolog [Eucalyptus grandis] gi|629112808|gb|KCW77768.1| hypothetical protein EUGRSUZ_D02068 [Eucalyptus grandis] Length = 227 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 380 VITAEDEKYRLGYGLMGKGVKAPWYLSKPEGFVD 279 V+TAEDEKYRLGYG+ GKGVK PWYL K VD Sbjct: 128 VVTAEDEKYRLGYGIAGKGVKLPWYLEKRGDHVD 161 >gb|KCW77767.1| hypothetical protein EUGRSUZ_D02068 [Eucalyptus grandis] Length = 236 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 380 VITAEDEKYRLGYGLMGKGVKAPWYLSKPEGFVD 279 V+TAEDEKYRLGYG+ GKGVK PWYL K VD Sbjct: 128 VVTAEDEKYRLGYGIAGKGVKLPWYLEKRGDHVD 161 >gb|KCW77759.1| hypothetical protein EUGRSUZ_D02058 [Eucalyptus grandis] Length = 201 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 380 VITAEDEKYRLGYGLMGKGVKAPWYLSKPEGFVD 279 V+TAEDEKYRLGYG+ GKGVK PWYL K VD Sbjct: 102 VVTAEDEKYRLGYGIAGKGVKLPWYLEKRGDHVD 135 >ref|XP_006355463.1| PREDICTED: leukocyte receptor cluster member 1 homolog [Solanum tuberosum] Length = 224 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 380 VITAEDEKYRLGYGLMGKGVKAPWYLSKPE 291 VIT EDEKYRLGYG++GKG K PWYL KP+ Sbjct: 133 VITPEDEKYRLGYGIVGKGTKLPWYLEKPK 162 >ref|XP_004246150.1| PREDICTED: leukocyte receptor cluster member 1 homolog [Solanum lycopersicum] Length = 224 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 380 VITAEDEKYRLGYGLMGKGVKAPWYLSKPE 291 VIT EDEKYRLGYG++GKG K PWYL KP+ Sbjct: 133 VITPEDEKYRLGYGIVGKGTKLPWYLEKPK 162