BLASTX nr result
ID: Ophiopogon21_contig00019377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00019377 (625 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009758214.1| PREDICTED: probable disease resistance prote... 57 6e-06 >ref|XP_009758214.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana sylvestris] Length = 962 Score = 57.4 bits (137), Expect = 6e-06 Identities = 30/80 (37%), Positives = 47/80 (58%) Frame = -2 Query: 624 PNLITLKLDSESYVDKELHFDGEGFGRLKTLRLYEIKSLESLAFGVGSMPSLRVLRVFCC 445 P L TL L +++ KE+ +GF LKTL++ E+ +LES +G+MP+L L + CC Sbjct: 816 PKLFTLSLRGSAFIGKEMCCSSQGFPLLKTLQIQELPNLESWRVEIGAMPNLIHLEIDCC 875 Query: 444 ESLYKVGKFDHENLPCLKEV 385 + L KV + L CL ++ Sbjct: 876 KKLEKV----PDELVCLTKI 891