BLASTX nr result
ID: Ophiopogon21_contig00018288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00018288 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010919096.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B... 59 1e-06 >ref|XP_010919096.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B [Elaeis guineensis] Length = 192 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/72 (45%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = -1 Query: 203 MGFPLGYSEXXXXXXXXXXXXXXXXXXXLISWAFNFAGLGDLLDSDAPW---PDPTNHPN 33 MGFP+GYSE LISW F GLGDLLDSD PW P P H Sbjct: 1 MGFPVGYSELLLPKLLLHTVFLLGFVRRLISWVFTAVGLGDLLDSDIPWSDPPPPNGHSQ 60 Query: 32 HHK--VQSVSAM 3 HH+ +S SAM Sbjct: 61 HHRPEFRSASAM 72