BLASTX nr result
ID: Ophiopogon21_contig00018028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00018028 (396 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796314.1| PREDICTED: proline-rich receptor-like protei... 61 3e-07 >ref|XP_008796314.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Phoenix dactylifera] Length = 241 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/46 (65%), Positives = 31/46 (67%) Frame = -1 Query: 387 PGLLPSPGSQFVPQSPSSFLNXXXXXXXXXXXXPGFQYPPPLTPNF 250 P LLPSPGSQFV SPS+FLN PGFQYPPPLTPNF Sbjct: 154 PALLPSPGSQFVVPSPSAFLNMLSPKSPYPLLSPGFQYPPPLTPNF 199