BLASTX nr result
ID: Ophiopogon21_contig00018016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00018016 (378 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010687248.1| PREDICTED: dolichyl-diphosphooligosaccharide... 91 3e-16 emb|CDO98566.1| unnamed protein product [Coffea canephora] 91 3e-16 gb|KNA16363.1| hypothetical protein SOVF_089290 [Spinacia oleracea] 91 4e-16 ref|XP_010103222.1| hypothetical protein L484_003540 [Morus nota... 91 4e-16 ref|XP_010037022.1| PREDICTED: dolichyl-diphosphooligosaccharide... 91 4e-16 ref|XP_009355928.1| PREDICTED: dolichyl-diphosphooligosaccharide... 91 4e-16 ref|XP_008393507.1| PREDICTED: dolichyl-diphosphooligosaccharide... 91 4e-16 ref|XP_008375065.1| PREDICTED: dolichyl-diphosphooligosaccharide... 91 4e-16 ref|XP_012079356.1| PREDICTED: dolichyl-diphosphooligosaccharide... 91 4e-16 ref|XP_010037023.1| PREDICTED: dolichyl-diphosphooligosaccharide... 91 4e-16 emb|CBI35275.3| unnamed protein product [Vitis vinifera] 91 4e-16 ref|XP_004299463.1| PREDICTED: dolichyl-diphosphooligosaccharide... 91 4e-16 ref|XP_002269119.2| PREDICTED: dolichyl-diphosphooligosaccharide... 91 4e-16 emb|CAN67600.1| hypothetical protein VITISV_012281 [Vitis vinifera] 91 4e-16 ref|XP_010940347.1| PREDICTED: dolichyl-diphosphooligosaccharide... 90 6e-16 ref|XP_010940345.1| PREDICTED: dolichyl-diphosphooligosaccharide... 90 6e-16 ref|XP_008803294.1| PREDICTED: dolichyl-diphosphooligosaccharide... 90 6e-16 ref|XP_006353938.1| PREDICTED: dolichyl-diphosphooligosaccharide... 90 6e-16 ref|XP_007152548.1| hypothetical protein PHAVU_004G139400g [Phas... 90 6e-16 ref|XP_006847859.1| PREDICTED: dolichyl-diphosphooligosaccharide... 90 6e-16 >ref|XP_010687248.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Beta vulgaris subsp. vulgaris] gi|870851717|gb|KMT03725.1| hypothetical protein BVRB_8g188740 [Beta vulgaris subsp. vulgaris] Length = 740 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKDVKLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 698 GYDRARGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPNNRW 740 >emb|CDO98566.1| unnamed protein product [Coffea canephora] Length = 725 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKDVKLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 683 GYDRARGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPNNRW 725 >gb|KNA16363.1| hypothetical protein SOVF_089290 [Spinacia oleracea] Length = 737 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKDVKLEYLEEA TTSNWIVRIYKVKPP NRW Sbjct: 695 GYDRARGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPKNRW 737 >ref|XP_010103222.1| hypothetical protein L484_003540 [Morus notabilis] gi|587907032|gb|EXB95062.1| hypothetical protein L484_003540 [Morus notabilis] Length = 102 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 60 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 102 >ref|XP_010037022.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B isoform X1 [Eucalyptus grandis] Length = 744 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 702 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 744 >ref|XP_009355928.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Pyrus x bretschneideri] Length = 747 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 705 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 747 >ref|XP_008393507.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Malus domestica] Length = 743 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 701 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 743 >ref|XP_008375065.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Malus domestica] Length = 747 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 705 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 747 >ref|XP_012079356.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Jatropha curcas] gi|643740123|gb|KDP45809.1| hypothetical protein JCGZ_17416 [Jatropha curcas] Length = 743 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 701 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 743 >ref|XP_010037023.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B isoform X2 [Eucalyptus grandis] gi|629082212|gb|KCW48657.1| hypothetical protein EUGRSUZ_K02314 [Eucalyptus grandis] Length = 743 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 701 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 743 >emb|CBI35275.3| unnamed protein product [Vitis vinifera] Length = 554 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 512 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 554 >ref|XP_004299463.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Fragaria vesca subsp. vesca] Length = 738 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 696 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 738 >ref|XP_002269119.2| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Vitis vinifera] Length = 741 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 699 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 741 >emb|CAN67600.1| hypothetical protein VITISV_012281 [Vitis vinifera] Length = 140 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP+NRW Sbjct: 98 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 140 >ref|XP_010940347.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B isoform X2 [Elaeis guineensis] Length = 676 Score = 90.1 bits (222), Expect = 6e-16 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP NRW Sbjct: 634 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNRW 676 >ref|XP_010940345.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B isoform X1 [Elaeis guineensis] Length = 733 Score = 90.1 bits (222), Expect = 6e-16 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP NRW Sbjct: 691 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNRW 733 >ref|XP_008803294.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Phoenix dactylifera] Length = 733 Score = 90.1 bits (222), Expect = 6e-16 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP NRW Sbjct: 691 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNRW 733 >ref|XP_006353938.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Solanum tuberosum] Length = 725 Score = 90.1 bits (222), Expect = 6e-16 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEA TTSNWIVRIYKVKPP NRW Sbjct: 683 GYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNRW 725 >ref|XP_007152548.1| hypothetical protein PHAVU_004G139400g [Phaseolus vulgaris] gi|561025857|gb|ESW24542.1| hypothetical protein PHAVU_004G139400g [Phaseolus vulgaris] Length = 723 Score = 90.1 bits (222), Expect = 6e-16 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 GYDRARGVEIGNKD+KLEYLEEALTT NWIVRIYKVKPP NRW Sbjct: 681 GYDRARGVEIGNKDIKLEYLEEALTTQNWIVRIYKVKPPKNRW 723 >ref|XP_006847859.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Amborella trichopoda] gi|548851164|gb|ERN09440.1| hypothetical protein AMTR_s00029p00078080 [Amborella trichopoda] Length = 733 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 378 GYDRARGVEIGNKDVKLEYLEEALTTSNWIVRIYKVKPPSNRW 250 G+DRARGVEIGNKDVKLEYLEEA TTSNWIVRIYKVKPPSNRW Sbjct: 691 GWDRARGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPSNRW 733