BLASTX nr result
ID: Ophiopogon21_contig00018003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00018003 (312 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009354293.1| PREDICTED: 26S proteasome non-ATPase regulat... 97 8e-23 ref|XP_010918461.1| PREDICTED: 26S proteasome non-ATPase regulat... 96 1e-22 ref|XP_008381580.1| PREDICTED: 26S proteasome non-ATPase regulat... 96 2e-22 ref|XP_004505542.1| PREDICTED: 26S proteasome non-ATPase regulat... 96 2e-22 ref|XP_008381581.1| PREDICTED: 26S proteasome non-ATPase regulat... 96 2e-22 ref|XP_010689792.1| PREDICTED: 26S proteasome non-ATPase regulat... 95 3e-22 ref|XP_008782016.1| PREDICTED: 26S proteasome non-ATPase regulat... 95 3e-22 ref|XP_010274582.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 4e-22 ref|XP_010274583.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 4e-22 ref|XP_010274584.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 4e-22 ref|XP_010274585.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 4e-22 ref|XP_008342883.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 5e-22 ref|XP_003607505.1| 26S proteasome regulatory subunit S2 1B [Med... 96 5e-22 gb|KHN08804.1| 26S proteasome non-ATPase regulatory subunit 2 1A... 94 5e-22 ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 5e-22 ref|XP_014494134.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 5e-22 ref|XP_013456679.1| 26S proteasome regulatory subunit S2 1B [Med... 96 5e-22 ref|XP_009357145.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 7e-22 ref|XP_010269890.1| PREDICTED: 26S proteasome non-ATPase regulat... 96 7e-22 ref|XP_010269892.1| PREDICTED: 26S proteasome non-ATPase regulat... 96 7e-22 >ref|XP_009354293.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Pyrus x bretschneideri] Length = 894 Score = 96.7 bits (239), Expect(2) = 8e-23 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM ESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 97 HYGTLKAYYETMAESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 146 Score = 37.0 bits (84), Expect(2) = 8e-23 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 183 LVQQIVAFHMKHNAEP 198 >ref|XP_010918461.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Elaeis guineensis] Length = 890 Score = 95.9 bits (237), Expect(2) = 1e-22 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAYFETM ES+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 94 HYGTLKAYFETMPESDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 143 Score = 37.0 bits (84), Expect(2) = 1e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 180 LVQQIVAFHMKHNAEP 195 >ref|XP_008381580.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X1 [Malus domestica] Length = 894 Score = 95.5 bits (236), Expect(2) = 2e-22 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM ESELKKYLADILSVLALTMSAEGERESLKYRLLGS+G Sbjct: 97 HYGTLKAYYETMAESELKKYLADILSVLALTMSAEGERESLKYRLLGSDG 146 Score = 37.0 bits (84), Expect(2) = 2e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 183 LVQQIVAFHMKHNAEP 198 >ref|XP_004505542.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Cicer arietinum] Length = 886 Score = 95.5 bits (236), Expect(2) = 2e-22 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM ES+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 90 HYGTLKAYYETMSESDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 139 Score = 37.0 bits (84), Expect(2) = 2e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 176 LVQQIVAFHMKHNAEP 191 >ref|XP_008381581.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X2 [Malus domestica] Length = 860 Score = 95.5 bits (236), Expect(2) = 2e-22 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM ESELKKYLADILSVLALTMSAEGERESLKYRLLGS+G Sbjct: 63 HYGTLKAYYETMAESELKKYLADILSVLALTMSAEGERESLKYRLLGSDG 112 Score = 37.0 bits (84), Expect(2) = 2e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 149 LVQQIVAFHMKHNAEP 164 >ref|XP_010689792.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Beta vulgaris subsp. vulgaris] gi|870849728|gb|KMT01948.1| hypothetical protein BVRB_9g209690 [Beta vulgaris subsp. vulgaris] Length = 894 Score = 94.7 bits (234), Expect(2) = 3e-22 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETMG+SELK++LADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 97 HYGTLKAYYETMGDSELKEFLADILSVLALTMSAEGERESLKYRLLGSEG 146 Score = 37.0 bits (84), Expect(2) = 3e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 183 LVQQIVAFHMKHNAEP 198 >ref|XP_008782016.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Phoenix dactylifera] Length = 876 Score = 94.7 bits (234), Expect(2) = 3e-22 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAYF+TM ES+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 79 HYGTLKAYFDTMPESDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 128 Score = 37.0 bits (84), Expect(2) = 3e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 165 LVQQIVAFHMKHNAEP 180 >ref|XP_010274582.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X1 [Nelumbo nucifera] Length = 912 Score = 94.4 bits (233), Expect(2) = 4e-22 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM +S+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 94 HYGTLKAYYETMADSDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 143 Score = 37.0 bits (84), Expect(2) = 4e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 181 LVQQIVAFHMKHNAEP 196 >ref|XP_010274583.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X2 [Nelumbo nucifera] Length = 911 Score = 94.4 bits (233), Expect(2) = 4e-22 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM +S+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 94 HYGTLKAYYETMADSDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 143 Score = 37.0 bits (84), Expect(2) = 4e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 180 LVQQIVAFHMKHNAEP 195 >ref|XP_010274584.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X3 [Nelumbo nucifera] Length = 892 Score = 94.4 bits (233), Expect(2) = 4e-22 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM +S+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 94 HYGTLKAYYETMADSDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 143 Score = 37.0 bits (84), Expect(2) = 4e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 181 LVQQIVAFHMKHNAEP 196 >ref|XP_010274585.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X4 [Nelumbo nucifera] Length = 891 Score = 94.4 bits (233), Expect(2) = 4e-22 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM +S+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 94 HYGTLKAYYETMADSDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 143 Score = 37.0 bits (84), Expect(2) = 4e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 180 LVQQIVAFHMKHNAEP 195 >ref|XP_008342883.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Malus domestica] Length = 894 Score = 94.0 bits (232), Expect(2) = 5e-22 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLK Y+ETM ESELKKYLADILSVLALTM+AEGERESLKYRLLGSEG Sbjct: 97 HYGTLKTYYETMAESELKKYLADILSVLALTMAAEGERESLKYRLLGSEG 146 Score = 37.0 bits (84), Expect(2) = 5e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 183 LVQQIVAFHMKHNAEP 198 >ref|XP_003607505.1| 26S proteasome regulatory subunit S2 1B [Medicago truncatula] gi|355508560|gb|AES89702.1| 26S proteasome regulatory subunit S2 1B [Medicago truncatula] Length = 886 Score = 95.5 bits (236), Expect(2) = 5e-22 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM ESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 90 HYGTLKAYYETMVESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 139 Score = 35.4 bits (80), Expect(2) = 5e-22 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LV+QIVAFHMKHNAEP Sbjct: 176 LVKQIVAFHMKHNAEP 191 >gb|KHN08804.1| 26S proteasome non-ATPase regulatory subunit 2 1A [Glycine soja] Length = 885 Score = 94.0 bits (232), Expect(2) = 5e-22 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLK Y+ETM ES+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 89 HYGTLKTYYETMAESDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 138 Score = 37.0 bits (84), Expect(2) = 5e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 175 LVQQIVAFHMKHNAEP 190 >ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Glycine max] gi|947076803|gb|KRH25643.1| hypothetical protein GLYMA_12G117600 [Glycine max] Length = 885 Score = 94.0 bits (232), Expect(2) = 5e-22 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLK Y+ETM ES+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 89 HYGTLKTYYETMAESDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 138 Score = 37.0 bits (84), Expect(2) = 5e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 175 LVQQIVAFHMKHNAEP 190 >ref|XP_014494134.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Vigna radiata var. radiata] Length = 884 Score = 94.0 bits (232), Expect(2) = 5e-22 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLK Y+ETM ES+LKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 89 HYGTLKTYYETMAESDLKKYLADILSVLALTMSAEGERESLKYRLLGSEG 138 Score = 37.0 bits (84), Expect(2) = 5e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 175 LVQQIVAFHMKHNAEP 190 >ref|XP_013456679.1| 26S proteasome regulatory subunit S2 1B [Medicago truncatula] gi|657388874|gb|KEH30710.1| 26S proteasome regulatory subunit S2 1B [Medicago truncatula] Length = 767 Score = 95.5 bits (236), Expect(2) = 5e-22 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM ESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG Sbjct: 90 HYGTLKAYYETMVESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 139 Score = 35.4 bits (80), Expect(2) = 5e-22 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LV+QIVAFHMKHNAEP Sbjct: 176 LVKQIVAFHMKHNAEP 191 >ref|XP_009357145.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Pyrus x bretschneideri] Length = 894 Score = 93.6 bits (231), Expect(2) = 7e-22 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETM ESELK YLADILSVLALTMSAEGERESLKYRLLGS+G Sbjct: 97 HYGTLKAYYETMAESELKNYLADILSVLALTMSAEGERESLKYRLLGSDG 146 Score = 37.0 bits (84), Expect(2) = 7e-22 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LVQQIVAFHMKHNAEP Sbjct: 183 LVQQIVAFHMKHNAEP 198 >ref|XP_010269890.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like isoform X1 [Nelumbo nucifera] Length = 892 Score = 96.3 bits (238), Expect(2) = 7e-22 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETMGES++KKYLADILS+LALTMSAEGERESLKYRLLGSEG Sbjct: 94 HYGTLKAYYETMGESDVKKYLADILSILALTMSAEGERESLKYRLLGSEG 143 Score = 34.3 bits (77), Expect(2) = 7e-22 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LV+QIV FHMKHNAEP Sbjct: 181 LVEQIVTFHMKHNAEP 196 >ref|XP_010269892.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like isoform X2 [Nelumbo nucifera] Length = 891 Score = 96.3 bits (238), Expect(2) = 7e-22 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -3 Query: 310 HYGTLKAYFETMGESELKKYLADILSVLALTMSAEGERESLKYRLLGSEG 161 HYGTLKAY+ETMGES++KKYLADILS+LALTMSAEGERESLKYRLLGSEG Sbjct: 94 HYGTLKAYYETMGESDVKKYLADILSILALTMSAEGERESLKYRLLGSEG 143 Score = 34.3 bits (77), Expect(2) = 7e-22 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 119 LVQQIVAFHMKHNAEP 72 LV+QIV FHMKHNAEP Sbjct: 180 LVEQIVTFHMKHNAEP 195