BLASTX nr result
ID: Ophiopogon21_contig00017783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00017783 (354 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010934198.1| PREDICTED: conserved oligomeric Golgi comple... 59 2e-06 gb|KNA08112.1| hypothetical protein SOVF_165600 [Spinacia oleracea] 57 4e-06 ref|XP_008785105.1| PREDICTED: conserved oligomeric Golgi comple... 57 5e-06 >ref|XP_010934198.1| PREDICTED: conserved oligomeric Golgi complex subunit 4 [Elaeis guineensis] Length = 760 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 174 FGNPDTLSQIRSLTDVGTMTRLLHECIAYQ 85 FG+P+TL+QIRSLTDVG MTRLLHECIAYQ Sbjct: 35 FGSPETLAQIRSLTDVGAMTRLLHECIAYQ 64 >gb|KNA08112.1| hypothetical protein SOVF_165600 [Spinacia oleracea] Length = 755 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 174 FGNPDTLSQIRSLTDVGTMTRLLHECIAYQ 85 FG+P+ LSQ++SLTDVGTMTRLLHECIAYQ Sbjct: 33 FGSPEALSQLQSLTDVGTMTRLLHECIAYQ 62 >ref|XP_008785105.1| PREDICTED: conserved oligomeric Golgi complex subunit 4 [Phoenix dactylifera] Length = 760 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 174 FGNPDTLSQIRSLTDVGTMTRLLHECIAYQ 85 FG+P+T +QIRSLTDVG MTRLLHECIAYQ Sbjct: 35 FGSPETFAQIRSLTDVGAMTRLLHECIAYQ 64