BLASTX nr result
ID: Ophiopogon21_contig00017385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00017385 (576 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006653095.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-l... 57 8e-06 >ref|XP_006653095.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha] Length = 706 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 4/52 (7%) Frame = +3 Query: 219 DPPPSQCKGRRKVQRFQHPSE---AKKPRTCKKCHMK-GHNIRTCKAKVDGG 362 DP S+CKG+RK QR + PSE AKK RTC CH K GHN+ TC K+ G Sbjct: 628 DPQISRCKGKRKPQRLKPPSEVKNAKKMRTCSYCHKKEGHNMATCPKKLKDG 679