BLASTX nr result
ID: Ophiopogon21_contig00017367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00017367 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008793823.1| PREDICTED: nuclear-pore anchor isoform X4 [P... 57 4e-06 ref|XP_008793822.1| PREDICTED: nuclear-pore anchor isoform X3 [P... 57 4e-06 ref|XP_008793821.1| PREDICTED: nuclear-pore anchor isoform X2 [P... 57 4e-06 ref|XP_008793820.1| PREDICTED: nuclear-pore anchor isoform X1 [P... 57 4e-06 >ref|XP_008793823.1| PREDICTED: nuclear-pore anchor isoform X4 [Phoenix dactylifera] Length = 2041 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/69 (50%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -2 Query: 364 NDN-DQAAPDSAQSPQKNAAAREGSPASLPQSTVSERRSPSTFATEMDEPAAARGGGRTI 188 NDN D APD+ QSPQ +A E P++ PQS VSE++S ST A + G RTI Sbjct: 1928 NDNSDHGAPDTVQSPQTSAGISEVPPSTPPQSAVSEQQSASTVADTEES-----RGHRTI 1982 Query: 187 TIAERARVN 161 TI+ERAR N Sbjct: 1983 TISERARQN 1991 >ref|XP_008793822.1| PREDICTED: nuclear-pore anchor isoform X3 [Phoenix dactylifera] Length = 2051 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/69 (50%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -2 Query: 364 NDN-DQAAPDSAQSPQKNAAAREGSPASLPQSTVSERRSPSTFATEMDEPAAARGGGRTI 188 NDN D APD+ QSPQ +A E P++ PQS VSE++S ST A + G RTI Sbjct: 1938 NDNSDHGAPDTVQSPQTSAGISEVPPSTPPQSAVSEQQSASTVADTEES-----RGHRTI 1992 Query: 187 TIAERARVN 161 TI+ERAR N Sbjct: 1993 TISERARQN 2001 >ref|XP_008793821.1| PREDICTED: nuclear-pore anchor isoform X2 [Phoenix dactylifera] Length = 2055 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/69 (50%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -2 Query: 364 NDN-DQAAPDSAQSPQKNAAAREGSPASLPQSTVSERRSPSTFATEMDEPAAARGGGRTI 188 NDN D APD+ QSPQ +A E P++ PQS VSE++S ST A + G RTI Sbjct: 1942 NDNSDHGAPDTVQSPQTSAGISEVPPSTPPQSAVSEQQSASTVADTEES-----RGHRTI 1996 Query: 187 TIAERARVN 161 TI+ERAR N Sbjct: 1997 TISERARQN 2005 >ref|XP_008793820.1| PREDICTED: nuclear-pore anchor isoform X1 [Phoenix dactylifera] Length = 2080 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/69 (50%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -2 Query: 364 NDN-DQAAPDSAQSPQKNAAAREGSPASLPQSTVSERRSPSTFATEMDEPAAARGGGRTI 188 NDN D APD+ QSPQ +A E P++ PQS VSE++S ST A + G RTI Sbjct: 1967 NDNSDHGAPDTVQSPQTSAGISEVPPSTPPQSAVSEQQSASTVADTEES-----RGHRTI 2021 Query: 187 TIAERARVN 161 TI+ERAR N Sbjct: 2022 TISERARQN 2030