BLASTX nr result
ID: Ophiopogon21_contig00017182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00017182 (1258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007148835.1| hypothetical protein PHAVU_005G018100g [Phas... 48 7e-06 >ref|XP_007148835.1| hypothetical protein PHAVU_005G018100g [Phaseolus vulgaris] gi|561022099|gb|ESW20829.1| hypothetical protein PHAVU_005G018100g [Phaseolus vulgaris] Length = 326 Score = 48.1 bits (113), Expect(2) = 7e-06 Identities = 32/85 (37%), Positives = 36/85 (42%) Frame = +1 Query: 649 HQQPKFPPFRSLPISVPSRALPPEHQPPALLWHQILIPSHSAPLRPRHHSISLQPNSHSS 828 HQ P P P VPS PP HQ P+ H P H AP H S + H S Sbjct: 129 HQAPS--PHHPPPHQVPSPHHPPPHQAPSPSPHHPS-PHHPAPHHSHHSHHSHHSSPHHS 185 Query: 829 RSPKTLPFPQSPTPHSPTWSPDPDP 903 SP P Q+P+PH P P P Sbjct: 186 PSPHHPPPHQAPSPHHPPPPQTPPP 210 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 951 PPISSPSPRHAMPPPATPLSFRSPPP 1028 PP +PSP H PPP P PPP Sbjct: 209 PPPQTPSPHHP-PPPQAPSPHHPPPP 233