BLASTX nr result
ID: Ophiopogon21_contig00017146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00017146 (578 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010935867.1| PREDICTED: putative pectinesterase 14 [Elaei... 57 9e-06 >ref|XP_010935867.1| PREDICTED: putative pectinesterase 14 [Elaeis guineensis] Length = 440 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 188 AYTKQLEQCKAAPSMDISYIDGNEWVLPPLQSDLWHNP 75 AY +QL+QC+AA MDISYIDG+EWVLPP S W NP Sbjct: 374 AYARQLDQCEAAQFMDISYIDGSEWVLPPYCSG-WSNP 410