BLASTX nr result
ID: Ophiopogon21_contig00017044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00017044 (1807 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093910.1| PREDICTED: leucine-rich repeat extensin-like... 74 6e-10 ref|XP_008786172.1| PREDICTED: leucine-rich repeat extensin-like... 71 3e-09 ref|XP_003630813.1| LRR extensin-like protein [Medicago truncatu... 71 3e-09 ref|XP_010925532.1| PREDICTED: leucine-rich repeat extensin-like... 70 5e-09 ref|XP_010252148.1| PREDICTED: leucine-rich repeat extensin-like... 70 6e-09 ref|XP_011078162.1| PREDICTED: leucine-rich repeat extensin-like... 70 8e-09 gb|KMZ56205.1| Pollen-specific leucine-rich repeat extensin-like... 69 1e-08 ref|XP_006851044.2| PREDICTED: LOW QUALITY PROTEIN: leucine-rich... 69 1e-08 gb|ERN12624.1| hypothetical protein AMTR_s00025p00231840 [Ambore... 69 1e-08 ref|XP_011100435.1| PREDICTED: leucine-rich repeat extensin-like... 69 2e-08 ref|XP_004512856.1| PREDICTED: leucine-rich repeat extensin-like... 69 2e-08 ref|XP_010050506.1| PREDICTED: leucine-rich repeat extensin-like... 68 2e-08 ref|XP_010655031.1| PREDICTED: leucine-rich repeat extensin-like... 68 3e-08 gb|KFK36221.1| hypothetical protein AALP_AA4G093700 [Arabis alpina] 68 3e-08 ref|XP_010091486.1| hypothetical protein L484_010328 [Morus nota... 65 5e-08 ref|XP_012854474.1| PREDICTED: leucine-rich repeat extensin-like... 67 5e-08 ref|XP_010440602.1| PREDICTED: leucine-rich repeat extensin-like... 67 5e-08 ref|XP_004512961.1| PREDICTED: leucine-rich repeat extensin-like... 67 5e-08 gb|KRH60296.1| hypothetical protein GLYMA_05G232000 [Glycine max] 67 7e-08 ref|XP_013644445.1| PREDICTED: leucine-rich repeat extensin-like... 67 7e-08 >ref|XP_011093910.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Sesamum indicum] Length = 784 Score = 73.6 bits (179), Expect = 6e-10 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 + PS+S+S+A V GI+LNHADIA YLPDE DL +FH+NSN FCG P + + LK Sbjct: 103 FCAPSLSNSSARVVAGIDLNHADIAGYLPDELGLLTDLALFHINSNRFCGVVPNSFKKLK 162 Query: 721 LHFE 710 L FE Sbjct: 163 LLFE 166 >ref|XP_008786172.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix dactylifera] Length = 678 Score = 71.2 bits (173), Expect = 3e-09 Identities = 35/64 (54%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y P SD + V GI+LNH DIA YLP+E DL +FH+NSN FCGT P ECL Sbjct: 109 YCAPLPSDPHLTVVAGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFECLH 168 Query: 721 LHFE 710 L FE Sbjct: 169 LLFE 172 >ref|XP_003630813.1| LRR extensin-like protein [Medicago truncatula] gi|355524835|gb|AET05289.1| LRR extensin-like protein [Medicago truncatula] Length = 712 Score = 71.2 bits (173), Expect = 3e-09 Identities = 35/64 (54%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y ++ + N V GI+LNHADIA YLPDE DL +FH+NSN FCGT P T + LK Sbjct: 76 YCAQALDNPNIRTVAGIDLNHADIAGYLPDELGLLTDLALFHINSNRFCGTVPHTFQKLK 135 Query: 721 LHFE 710 L FE Sbjct: 136 LLFE 139 >ref|XP_010925532.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Elaeis guineensis] Length = 523 Score = 70.5 bits (171), Expect = 5e-09 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 + P SD + + V GI+LNH DIA YLP+E DL +FH+NSN FCGT P ECL Sbjct: 109 FCAPLPSDPHLIVVAGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTIPHKFECLH 168 Query: 721 LHFE 710 L FE Sbjct: 169 LLFE 172 >ref|XP_010252148.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo nucifera] Length = 770 Score = 70.1 bits (170), Expect = 6e-09 Identities = 36/64 (56%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y PS+ +S+ V GI+LNHADIA YLP E DL +FHLNSN FCG PRT LK Sbjct: 91 YCSPSLFNSSVTVVSGIDLNHADIAGYLPPELGLLTDLALFHLNSNRFCGIVPRTFRRLK 150 Query: 721 LHFE 710 L +E Sbjct: 151 LLYE 154 >ref|XP_011078162.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Sesamum indicum] Length = 712 Score = 69.7 bits (169), Expect = 8e-09 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = -1 Query: 877 SMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLKLHFE 710 S S+S+ V GI+LNHADIA YLPDE DL +FH+NSN FCG P + E LKL FE Sbjct: 105 SQSNSSVRVVAGIDLNHADIAGYLPDELGLLTDLALFHINSNRFCGVVPESFEKLKLLFE 164 >gb|KMZ56205.1| Pollen-specific leucine-rich repeat extensin-like protein 4 [Zostera marina] Length = 671 Score = 68.9 bits (167), Expect = 1e-08 Identities = 33/60 (55%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = -1 Query: 877 SMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLKLHFE 710 S+ D N V GI+LNH DIA YLPDE DL +FH+NSN FCGT P+ + +KL FE Sbjct: 102 SVLDPNVTVVAGIDLNHGDIAGYLPDELKLLEDLALFHINSNRFCGTVPKKIHTMKLLFE 161 >ref|XP_006851044.2| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like protein 4 [Amborella trichopoda] Length = 811 Score = 68.9 bits (167), Expect = 1e-08 Identities = 35/64 (54%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 + PS SDS+ V GI+LNHADIA YLP E DL +FH+NSN FCG P T + +K Sbjct: 53 FCAPSPSDSSLNVVAGIDLNHADIAGYLPPELGLLSDLALFHINSNRFCGVVPPTFKRMK 112 Query: 721 LHFE 710 L FE Sbjct: 113 LLFE 116 >gb|ERN12624.1| hypothetical protein AMTR_s00025p00231840 [Amborella trichopoda] Length = 204 Score = 68.9 bits (167), Expect = 1e-08 Identities = 35/64 (54%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 + PS SDS+ V GI+LNHADIA YLP E DL +FH+NSN FCG P T + +K Sbjct: 87 FCAPSPSDSSLNVVAGIDLNHADIAGYLPPELGLLSDLALFHINSNRFCGVVPPTFKRMK 146 Query: 721 LHFE 710 L FE Sbjct: 147 LLFE 150 >ref|XP_011100435.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum indicum] Length = 389 Score = 68.6 bits (166), Expect = 2e-08 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y P ++D+N + V GI+LNHADIA +LPDE +L + HLNSN FCG P T+ L Sbjct: 81 YCAPHLNDTNVLVVAGIDLNHADIAGFLPDELGLLSELALLHLNSNRFCGILPPTLSNLS 140 Query: 721 LHFE 710 L FE Sbjct: 141 LLFE 144 >ref|XP_004512856.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Cicer arietinum] Length = 642 Score = 68.6 bits (166), Expect = 2e-08 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDER----DLTVFHLNSNHFCGTNPRTMECLK 722 Y ++ + N V GI+LNHADIA YLPDE DL +FH+NSN FCGT P + LK Sbjct: 86 YCAQALDNPNIRTVAGIDLNHADIAGYLPDELGLLVDLALFHINSNRFCGTVPHSFNKLK 145 Query: 721 LHFE 710 L FE Sbjct: 146 LLFE 149 >ref|XP_010050506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus grandis] Length = 425 Score = 68.2 bits (165), Expect = 2e-08 Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y P++ D V GI+LNH DIA YLP+E DL +FH+NSN FCGT P + LK Sbjct: 122 YCAPAIDDPKIRTVAGIDLNHGDIAGYLPEELGLLADLALFHINSNRFCGTVPHKFDRLK 181 Query: 721 LHFE 710 L FE Sbjct: 182 LLFE 185 >ref|XP_010655031.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Vitis vinifera] Length = 737 Score = 67.8 bits (164), Expect = 3e-08 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y PS+S+ + V GI+LNHADIA YLP E DL +FHLNSN FCG P +++ +K Sbjct: 81 YCAPSLSNPSLKVVAGIDLNHADIAGYLPSELGLLSDLALFHLNSNRFCGIVPSSLKRMK 140 Query: 721 LHFE 710 L +E Sbjct: 141 LLYE 144 >gb|KFK36221.1| hypothetical protein AALP_AA4G093700 [Arabis alpina] Length = 844 Score = 67.8 bits (164), Expect = 3e-08 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 + PS+ + V GI+LNHADIA YLP+E DL +FH+NSN FCGT P + LK Sbjct: 104 FCSPSLDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFKSLK 163 Query: 721 LHFE 710 L FE Sbjct: 164 LLFE 167 >ref|XP_010091486.1| hypothetical protein L484_010328 [Morus notabilis] gi|587854594|gb|EXB44637.1| hypothetical protein L484_010328 [Morus notabilis] Length = 398 Score = 65.5 bits (158), Expect(2) = 5e-08 Identities = 33/64 (51%), Positives = 39/64 (60%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y PS+ D+ V GI+LNHADIA LPDE DL + HLNSN FCG P T+ L Sbjct: 83 YCAPSIHDNKTQVVAGIDLNHADIAGSLPDELGLLSDLALIHLNSNRFCGVLPSTLSNLS 142 Query: 721 LHFE 710 L +E Sbjct: 143 LLYE 146 Score = 21.6 bits (44), Expect(2) = 5e-08 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 1023 AAAFRHRHHTQGQRLSDLPVALELVGSEIRSDP 925 A+A HR RL +AL+ + I+SDP Sbjct: 32 ASARSHRPADSNPRLHQAFIALQAWKAAIQSDP 64 >ref|XP_012854474.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Erythranthe guttatus] Length = 389 Score = 67.0 bits (162), Expect = 5e-08 Identities = 31/64 (48%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 + P++ D + V GI+LNH DIA YLP+E DL +FH+NSN FCGT P+ + LK Sbjct: 130 FCAPALDDPSIQTVAGIDLNHGDIAGYLPEELGLLTDLGIFHINSNRFCGTVPKKFKNLK 189 Query: 721 LHFE 710 + FE Sbjct: 190 VLFE 193 >ref|XP_010440602.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina sativa] Length = 720 Score = 67.0 bits (162), Expect = 5e-08 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 + PS+++ V GI+LNHADIA YLP+E DL +FH+NSN FCGT P LK Sbjct: 101 FCSPSLNNRKIRTVAGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLK 160 Query: 721 LHFE 710 L FE Sbjct: 161 LLFE 164 >ref|XP_004512961.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Cicer arietinum] Length = 745 Score = 67.0 bits (162), Expect = 5e-08 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y P++ + V GI+LNH DIA YLP+E DL +FH+NSN FCGT P E LK Sbjct: 119 YCAPALDNPKIQTVAGIDLNHCDIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFENLK 178 Query: 721 LHFE 710 + FE Sbjct: 179 ILFE 182 >gb|KRH60296.1| hypothetical protein GLYMA_05G232000 [Glycine max] Length = 713 Score = 66.6 bits (161), Expect = 7e-08 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDER----DLTVFHLNSNHFCGTNPRTMECLK 722 Y P++ + N V GI+LNH DIA YLP E DL +FH+NSN FCGT P + LK Sbjct: 85 YCAPALDNPNIRTVAGIDLNHGDIAGYLPQELGLLVDLALFHINSNRFCGTVPHKFDRLK 144 Query: 721 LHFE 710 L +E Sbjct: 145 LLYE 148 >ref|XP_013644445.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Brassica napus] Length = 793 Score = 66.6 bits (161), Expect = 7e-08 Identities = 34/64 (53%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = -1 Query: 889 YSPPSMSDSNAMAVVGINLNHADIASYLPDE----RDLTVFHLNSNHFCGTNPRTMECLK 722 Y PS S V GI+LNHAD+A YLP E DL +FHLNSN FCGT P T + +K Sbjct: 88 YCAPSPSRPKTRVVAGIDLNHADMAGYLPPELGLLTDLALFHLNSNRFCGTVPTTFKRMK 147 Query: 721 LHFE 710 L +E Sbjct: 148 LLYE 151