BLASTX nr result
ID: Ophiopogon21_contig00016840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00016840 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010930452.1| PREDICTED: uncharacterized protein LOC105051... 109 7e-22 ref|XP_008800076.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 107 3e-21 ref|XP_008235934.1| PREDICTED: uncharacterized CRM domain-contai... 104 2e-20 ref|XP_009387065.1| PREDICTED: uncharacterized CRM domain-contai... 103 4e-20 ref|XP_004290124.2| PREDICTED: uncharacterized CRM domain-contai... 102 1e-19 dbj|BAS89860.1| Os04g0492900, partial [Oryza sativa Japonica Group] 101 2e-19 ref|NP_001053180.1| Os04g0492900 [Oryza sativa Japonica Group] g... 101 2e-19 gb|EAZ31202.1| hypothetical protein OsJ_15301 [Oryza sativa Japo... 101 2e-19 gb|KQJ83319.1| hypothetical protein BRADI_5g14290 [Brachypodium ... 100 6e-19 ref|XP_010240061.1| PREDICTED: uncharacterized CRM domain-contai... 100 6e-19 ref|XP_010240060.1| PREDICTED: uncharacterized CRM domain-contai... 100 6e-19 ref|XP_009349305.1| PREDICTED: uncharacterized CRM domain-contai... 100 6e-19 ref|XP_009349288.1| PREDICTED: uncharacterized CRM domain-contai... 100 6e-19 ref|XP_009349287.1| PREDICTED: uncharacterized CRM domain-contai... 100 6e-19 ref|XP_007201262.1| hypothetical protein PRUPE_ppa008449mg [Prun... 100 6e-19 ref|XP_012833581.1| PREDICTED: uncharacterized CRM domain-contai... 99 9e-19 ref|XP_009779436.1| PREDICTED: uncharacterized CRM domain-contai... 99 9e-19 gb|EYU40668.1| hypothetical protein MIMGU_mgv1a007847mg [Erythra... 99 9e-19 ref|XP_009359005.1| PREDICTED: uncharacterized CRM domain-contai... 99 2e-18 ref|XP_004242444.2| PREDICTED: uncharacterized CRM domain-contai... 98 2e-18 >ref|XP_010930452.1| PREDICTED: uncharacterized protein LOC105051625 [Elaeis guineensis] Length = 795 Score = 109 bits (273), Expect = 7e-22 Identities = 60/93 (64%), Positives = 70/93 (75%) Frame = -2 Query: 370 TMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASK 191 T S+SEDLSD+FETDS+GE E+K EKPLYL E+F S + G DFE HLRQI+AASK Sbjct: 704 TWSDSEDLSDIFETDSEGET-EDKLEKPLYLDAVERFPSVNGGMPDDFEEHLRQIAAASK 762 Query: 190 RNNSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 +S E D K+ DLDEIDKIFLRA LL K+RR Sbjct: 763 IGDSLEKDVKLEDLDEIDKIFLRASSLLKKRRR 795 >ref|XP_008800076.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Phoenix dactylifera] Length = 503 Score = 107 bits (267), Expect = 3e-21 Identities = 58/93 (62%), Positives = 70/93 (75%) Frame = -2 Query: 370 TMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASK 191 T S+SEDLSD+FETDS+GE E+K EKPLYL E+F S + G DFE HLRQI+AASK Sbjct: 412 TWSDSEDLSDIFETDSEGET-EDKLEKPLYLDAVERFPSVNGGTPDDFEEHLRQIAAASK 470 Query: 190 RNNSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 +S E D K+ +LDEIDKIFLRA LL ++RR Sbjct: 471 IGDSLEKDVKLEELDEIDKIFLRASSLLKRRRR 503 >ref|XP_008235934.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Prunus mume] Length = 630 Score = 104 bits (260), Expect = 2e-20 Identities = 57/91 (62%), Positives = 65/91 (71%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SEDLSD+FETDSD E EEK E+PLYL FEKF DGE DFE HLRQIS SK+ Sbjct: 541 SDSEDLSDIFETDSDKET-EEKAERPLYLEEFEKFPVEGDGEPEDFEDHLRQISMDSKKA 599 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 S DA + + DE+D+IFLRA LL KKRR Sbjct: 600 KSANEDADLPNFDEVDRIFLRAASLLKKKRR 630 >ref|XP_009387065.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Musa acuminata subsp. malaccensis] Length = 654 Score = 103 bits (258), Expect = 4e-20 Identities = 57/90 (63%), Positives = 65/90 (72%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 SE+EDLSD+FETDSD E ME K E+PLYL EKF S D E DFE HLRQI+AASKR Sbjct: 566 SETEDLSDMFETDSDMEVME-KSERPLYLDEVEKFPSNIDEEPKDFEEHLRQIAAASKRI 624 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKR 95 + D K+ DLD +DKIFLRA LL K+R Sbjct: 625 DLSTKDVKLADLDAVDKIFLRASSLLKKRR 654 >ref|XP_004290124.2| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Fragaria vesca subsp. vesca] Length = 703 Score = 102 bits (254), Expect = 1e-19 Identities = 54/91 (59%), Positives = 65/91 (71%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SEDLSD+FETDS+ E E K ++PLYL FEKF DGE DFE HLRQIS SK+ Sbjct: 614 SDSEDLSDIFETDSEKES-ENKVQRPLYLEEFEKFLVESDGEPDDFEDHLRQISMDSKKA 672 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 SP +A + + DE+D+IFLRA LL KKRR Sbjct: 673 KSPNENAGLPNFDEVDRIFLRAASLLKKKRR 703 >dbj|BAS89860.1| Os04g0492900, partial [Oryza sativa Japonica Group] Length = 340 Score = 101 bits (252), Expect = 2e-19 Identities = 52/93 (55%), Positives = 70/93 (75%), Gaps = 1/93 (1%) Frame = -2 Query: 373 VTMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFS-GDDGEEVDFETHLRQISAA 197 +T SESEDLSD+FETDS+ E+++E +E+PLYL +KF S +D E DFE HLR+I++ Sbjct: 248 ITYSESEDLSDIFETDSEEEQVQESKEQPLYLDKLDKFPSENNDNEPDDFEEHLRKIASL 307 Query: 196 SKRNNSPENDAKVTDLDEIDKIFLRADYLLNKK 98 S R +S + KV++LDEIDKIFLRA LL K+ Sbjct: 308 SDRTDSSAKELKVSELDEIDKIFLRASSLLKKR 340 >ref|NP_001053180.1| Os04g0492900 [Oryza sativa Japonica Group] gi|21740788|emb|CAD41533.1| OSJNBb0091E11.2 [Oryza sativa Japonica Group] gi|38346227|emb|CAE02049.2| OJ990528_30.7 [Oryza sativa Japonica Group] gi|90265163|emb|CAH67731.1| H0522A01.2 [Oryza sativa Indica Group] gi|113564751|dbj|BAF15094.1| Os04g0492900 [Oryza sativa Japonica Group] gi|116310744|emb|CAH67539.1| H0425E08.7 [Oryza sativa Indica Group] gi|125548841|gb|EAY94663.1| hypothetical protein OsI_16441 [Oryza sativa Indica Group] gi|937914939|dbj|BAS89858.1| Os04g0492900 [Oryza sativa Japonica Group] Length = 479 Score = 101 bits (252), Expect = 2e-19 Identities = 52/93 (55%), Positives = 70/93 (75%), Gaps = 1/93 (1%) Frame = -2 Query: 373 VTMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFS-GDDGEEVDFETHLRQISAA 197 +T SESEDLSD+FETDS+ E+++E +E+PLYL +KF S +D E DFE HLR+I++ Sbjct: 387 ITYSESEDLSDIFETDSEEEQVQESKEQPLYLDKLDKFPSENNDNEPDDFEEHLRKIASL 446 Query: 196 SKRNNSPENDAKVTDLDEIDKIFLRADYLLNKK 98 S R +S + KV++LDEIDKIFLRA LL K+ Sbjct: 447 SDRTDSSAKELKVSELDEIDKIFLRASSLLKKR 479 >gb|EAZ31202.1| hypothetical protein OsJ_15301 [Oryza sativa Japonica Group] Length = 484 Score = 101 bits (252), Expect = 2e-19 Identities = 52/93 (55%), Positives = 70/93 (75%), Gaps = 1/93 (1%) Frame = -2 Query: 373 VTMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFS-GDDGEEVDFETHLRQISAA 197 +T SESEDLSD+FETDS+ E+++E +E+PLYL +KF S +D E DFE HLR+I++ Sbjct: 392 ITYSESEDLSDIFETDSEEEQVQESKEQPLYLDKLDKFPSENNDNEPDDFEEHLRKIASL 451 Query: 196 SKRNNSPENDAKVTDLDEIDKIFLRADYLLNKK 98 S R +S + KV++LDEIDKIFLRA LL K+ Sbjct: 452 SDRTDSSAKELKVSELDEIDKIFLRASSLLKKR 484 >gb|KQJ83319.1| hypothetical protein BRADI_5g14290 [Brachypodium distachyon] Length = 509 Score = 100 bits (248), Expect = 6e-19 Identities = 50/93 (53%), Positives = 71/93 (76%), Gaps = 1/93 (1%) Frame = -2 Query: 373 VTMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFF-SGDDGEEVDFETHLRQISAA 197 +T SESEDLSD+FETDS+ E++E+ +E+PLYL + +KF +D E DFE HLR+I++ Sbjct: 418 ITCSESEDLSDIFETDSE-EQVEDTKERPLYLDSLDKFLPESNDNEPDDFEEHLRKIASL 476 Query: 196 SKRNNSPENDAKVTDLDEIDKIFLRADYLLNKK 98 S + +SP + K+++LDEIDKIFLRA LL K+ Sbjct: 477 SDKTDSPAKELKISELDEIDKIFLRASSLLKKR 509 >ref|XP_010240061.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X2 [Brachypodium distachyon] gi|944047677|gb|KQJ83318.1| hypothetical protein BRADI_5g14290 [Brachypodium distachyon] Length = 392 Score = 100 bits (248), Expect = 6e-19 Identities = 50/93 (53%), Positives = 71/93 (76%), Gaps = 1/93 (1%) Frame = -2 Query: 373 VTMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFF-SGDDGEEVDFETHLRQISAA 197 +T SESEDLSD+FETDS+ E++E+ +E+PLYL + +KF +D E DFE HLR+I++ Sbjct: 301 ITCSESEDLSDIFETDSE-EQVEDTKERPLYLDSLDKFLPESNDNEPDDFEEHLRKIASL 359 Query: 196 SKRNNSPENDAKVTDLDEIDKIFLRADYLLNKK 98 S + +SP + K+++LDEIDKIFLRA LL K+ Sbjct: 360 SDKTDSPAKELKISELDEIDKIFLRASSLLKKR 392 >ref|XP_010240060.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Brachypodium distachyon] Length = 480 Score = 100 bits (248), Expect = 6e-19 Identities = 50/93 (53%), Positives = 71/93 (76%), Gaps = 1/93 (1%) Frame = -2 Query: 373 VTMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFF-SGDDGEEVDFETHLRQISAA 197 +T SESEDLSD+FETDS+ E++E+ +E+PLYL + +KF +D E DFE HLR+I++ Sbjct: 389 ITCSESEDLSDIFETDSE-EQVEDTKERPLYLDSLDKFLPESNDNEPDDFEEHLRKIASL 447 Query: 196 SKRNNSPENDAKVTDLDEIDKIFLRADYLLNKK 98 S + +SP + K+++LDEIDKIFLRA LL K+ Sbjct: 448 SDKTDSPAKELKISELDEIDKIFLRASSLLKKR 480 >ref|XP_009349305.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic-like [Pyrus x bretschneideri] Length = 660 Score = 100 bits (248), Expect = 6e-19 Identities = 52/91 (57%), Positives = 67/91 (73%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SEDLSD+F+TDS+ E E+K E+PLYL FEKF DGE DFE HLRQIS +K++ Sbjct: 571 SDSEDLSDIFDTDSEKET-EKKAERPLYLEEFEKFPVESDGEPEDFEDHLRQISRDAKKD 629 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 S + DA + + DE+D++FLRA LL KKRR Sbjct: 630 KSLDEDAGLPNFDEVDRVFLRAASLLKKKRR 660 >ref|XP_009349288.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 454 Score = 100 bits (248), Expect = 6e-19 Identities = 52/91 (57%), Positives = 67/91 (73%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SEDLSD+F+TDS+ E E+K E+PLYL FEKF DGE DFE HLRQIS +K++ Sbjct: 365 SDSEDLSDIFDTDSEKET-EKKAERPLYLEEFEKFPVESDGEPEDFEDHLRQISRDAKKD 423 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 S + DA + + DE+D++FLRA LL KKRR Sbjct: 424 KSLDEDAGLPNFDEVDRVFLRAASLLKKKRR 454 >ref|XP_009349287.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 455 Score = 100 bits (248), Expect = 6e-19 Identities = 52/91 (57%), Positives = 67/91 (73%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SEDLSD+F+TDS+ E E+K E+PLYL FEKF DGE DFE HLRQIS +K++ Sbjct: 366 SDSEDLSDIFDTDSEKET-EKKAERPLYLEEFEKFPVESDGEPEDFEDHLRQISRDAKKD 424 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 S + DA + + DE+D++FLRA LL KKRR Sbjct: 425 KSLDEDAGLPNFDEVDRVFLRAASLLKKKRR 455 >ref|XP_007201262.1| hypothetical protein PRUPE_ppa008449mg [Prunus persica] gi|462396662|gb|EMJ02461.1| hypothetical protein PRUPE_ppa008449mg [Prunus persica] Length = 331 Score = 100 bits (248), Expect = 6e-19 Identities = 55/90 (61%), Positives = 63/90 (70%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SE LSD+FETDSD E EEK E+PLYL FEKF DGE DFE HLRQIS SK+ Sbjct: 242 SDSEHLSDIFETDSDKET-EEKAERPLYLEEFEKFPVESDGEPEDFEDHLRQISMDSKKA 300 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKR 95 S DA + + DE+D+IFLRA LL KKR Sbjct: 301 KSVNEDADLPNFDEVDRIFLRAASLLKKKR 330 >ref|XP_012833581.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Erythranthe guttatus] Length = 500 Score = 99.4 bits (246), Expect = 9e-19 Identities = 51/91 (56%), Positives = 67/91 (73%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SE LSD+FETD + E E KEEKPLY+ FEK + DG+E DFE HLR+ISA S++ Sbjct: 411 SDSEALSDMFETDLESEN-EVKEEKPLYMDEFEKIPADSDGDEDDFEEHLRRISADSRKE 469 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 + + DA++ DLDEID++ LRA LL KKR+ Sbjct: 470 KNSDTDAELADLDEIDRMVLRAASLLKKKRK 500 >ref|XP_009779436.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic-like [Nicotiana sylvestris] Length = 501 Score = 99.4 bits (246), Expect = 9e-19 Identities = 52/92 (56%), Positives = 66/92 (71%) Frame = -2 Query: 367 MSESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKR 188 +S+SEDLSD+FETDSD E +E EE PLYL FEKF +GEE DFE HLRQIS+ S++ Sbjct: 409 VSDSEDLSDIFETDSDEEDEDETEE-PLYLDEFEKFHVHSNGEEQDFEEHLRQISSNSRK 467 Query: 187 NNSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 S DA DLDE+D++ L+A LL KK++ Sbjct: 468 EKSVCKDADTPDLDEVDRMILQATSLLKKKKK 499 >gb|EYU40668.1| hypothetical protein MIMGU_mgv1a007847mg [Erythranthe guttata] Length = 393 Score = 99.4 bits (246), Expect = 9e-19 Identities = 51/91 (56%), Positives = 67/91 (73%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SE LSD+FETD + E E KEEKPLY+ FEK + DG+E DFE HLR+ISA S++ Sbjct: 304 SDSEALSDMFETDLESEN-EVKEEKPLYMDEFEKIPADSDGDEDDFEEHLRRISADSRKE 362 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 + + DA++ DLDEID++ LRA LL KKR+ Sbjct: 363 KNSDTDAELADLDEIDRMVLRAASLLKKKRK 393 >ref|XP_009359005.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic-like [Pyrus x bretschneideri] Length = 647 Score = 98.6 bits (244), Expect = 2e-18 Identities = 51/91 (56%), Positives = 66/91 (72%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SEDLSD+F+TDS+ E E+K E+PLYL FEKF DGE DFE HLRQIS +K++ Sbjct: 558 SDSEDLSDIFDTDSEKET-EKKAERPLYLEEFEKFPVESDGEPEDFEDHLRQISRDAKKD 616 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 S + D + + DE+D++FLRA LL KKRR Sbjct: 617 KSLDEDVGLPNFDEVDRVFLRAASLLKKKRR 647 >ref|XP_004242444.2| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Solanum lycopersicum] Length = 611 Score = 98.2 bits (243), Expect = 2e-18 Identities = 51/91 (56%), Positives = 65/91 (71%) Frame = -2 Query: 364 SESEDLSDLFETDSDGEKMEEKEEKPLYLGTFEKFFSGDDGEEVDFETHLRQISAASKRN 185 S+SEDLSD+FETDS+ E+ EEK E+PLYL FEKF +G+ DFE HLRQIS+ S++ Sbjct: 522 SDSEDLSDIFETDSE-EEHEEKAEEPLYLDVFEKFPVQSNGDAQDFEEHLRQISSNSRKE 580 Query: 184 NSPENDAKVTDLDEIDKIFLRADYLLNKKRR 92 SP D LDE+DKI L+A LL K++R Sbjct: 581 KSPGKDVDTPGLDEVDKIILQATSLLKKQKR 611