BLASTX nr result
ID: Ophiopogon21_contig00015717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00015717 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010649965.1| PREDICTED: meiotic recombination protein DMC... 62 1e-07 ref|XP_010649964.1| PREDICTED: meiotic recombination protein DMC... 62 1e-07 ref|XP_013469737.1| meiotic recombination protein DMC1, putative... 62 1e-07 emb|CBI26317.3| unnamed protein product [Vitis vinifera] 62 1e-07 emb|CAN71783.1| hypothetical protein VITISV_028799 [Vitis vinifera] 62 1e-07 ref|XP_012069715.1| PREDICTED: meiotic recombination protein DMC... 62 2e-07 ref|XP_006489468.1| PREDICTED: meiotic recombination protein DMC... 62 2e-07 ref|XP_006420045.1| hypothetical protein CICLE_v10006682mg [Citr... 62 2e-07 ref|XP_002441706.1| hypothetical protein SORBIDRAFT_08g001020 [S... 62 2e-07 sp|P37384.1|DMC1_LILLO RecName: Full=Meiotic recombination prote... 61 3e-07 ref|XP_010279268.1| PREDICTED: meiotic recombination protein DMC... 61 3e-07 ref|XP_010279267.1| PREDICTED: meiotic recombination protein DMC... 61 3e-07 ref|XP_002453596.1| hypothetical protein SORBIDRAFT_04g008730 [S... 61 3e-07 gb|KQJ92333.1| hypothetical protein BRADI_4g42957 [Brachypodium ... 61 4e-07 ref|XP_012487204.1| PREDICTED: meiotic recombination protein DMC... 61 4e-07 ref|XP_012487202.1| PREDICTED: meiotic recombination protein DMC... 61 4e-07 gb|KJB38194.1| hypothetical protein B456_006G243000 [Gossypium r... 61 4e-07 gb|KJB38193.1| hypothetical protein B456_006G243000 [Gossypium r... 61 4e-07 ref|XP_010239525.1| PREDICTED: meiotic recombination protein DMC... 61 4e-07 ref|XP_010061767.1| PREDICTED: meiotic recombination protein DMC... 61 4e-07 >ref|XP_010649965.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X2 [Vitis vinifera] Length = 344 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 248 MHDEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 + DEED E+I KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 21 IEDEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >ref|XP_010649964.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X1 [Vitis vinifera] Length = 349 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 248 MHDEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 + DEED E+I KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 21 IEDEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >ref|XP_013469737.1| meiotic recombination protein DMC1, putative [Medicago truncatula] gi|657405282|gb|KEH43775.1| meiotic recombination protein DMC1, putative [Medicago truncatula] Length = 311 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 248 MHDEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 M DEED E+I KLISQ +AGDV LQDAGI+TCN LMMH K Sbjct: 1 MEDEEDLFEAIDKLISQGINAGDVKKLQDAGIFTCNGLMMHTK 43 >emb|CBI26317.3| unnamed protein product [Vitis vinifera] Length = 348 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 248 MHDEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 + DEED E+I KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 21 IEDEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >emb|CAN71783.1| hypothetical protein VITISV_028799 [Vitis vinifera] Length = 348 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 248 MHDEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 + DEED E+I KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 21 IEDEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >ref|XP_012069715.1| PREDICTED: meiotic recombination protein DMC1 homolog [Jatropha curcas] gi|643733292|gb|KDP40239.1| hypothetical protein JCGZ_02237 [Jatropha curcas] Length = 344 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEED E+I KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >ref|XP_006489468.1| PREDICTED: meiotic recombination protein DMC1 homolog [Citrus sinensis] Length = 344 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEED E+I KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >ref|XP_006420045.1| hypothetical protein CICLE_v10006682mg [Citrus clementina] gi|557521918|gb|ESR33285.1| hypothetical protein CICLE_v10006682mg [Citrus clementina] gi|641855656|gb|KDO74436.1| hypothetical protein CISIN_1g047388mg [Citrus sinensis] Length = 352 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEED E+I KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEDLFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >ref|XP_002441706.1| hypothetical protein SORBIDRAFT_08g001020 [Sorghum bicolor] gi|241942399|gb|EES15544.1| hypothetical protein SORBIDRAFT_08g001020 [Sorghum bicolor] Length = 344 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 248 MHDEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 + DEE+ ESI KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 21 VEDEEECFESIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >sp|P37384.1|DMC1_LILLO RecName: Full=Meiotic recombination protein DMC1 homolog gi|431168|dbj|BAA04845.1| RAD51-like protein [Lilium longiflorum] Length = 349 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 +EED ESI KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 28 EEEDCFESIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 68 >ref|XP_010279268.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X2 [Nelumbo nucifera] Length = 343 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMKLS 114 DEE+ E+I KLISQ +AGDV LQDAGIYTCN LMMH K S Sbjct: 22 DEEELFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTKKS 64 >ref|XP_010279267.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X1 [Nelumbo nucifera] Length = 353 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMKLS 114 DEE+ E+I KLISQ +AGDV LQDAGIYTCN LMMH K S Sbjct: 22 DEEELFEAIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTKKS 64 >ref|XP_002453596.1| hypothetical protein SORBIDRAFT_04g008730 [Sorghum bicolor] gi|241933427|gb|EES06572.1| hypothetical protein SORBIDRAFT_04g008730 [Sorghum bicolor] Length = 344 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEE+ ESI KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEECFESIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63 >gb|KQJ92333.1| hypothetical protein BRADI_4g42957 [Brachypodium distachyon] Length = 345 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -3 Query: 248 MHDEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMKLS 114 + +EE+ ESI KLISQ +AGDV LQDAGIYTCN LMMH K S Sbjct: 22 VEEEEECFESIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTKKS 66 >ref|XP_012487204.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X2 [Gossypium raimondii] Length = 344 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEED ESI KLIS +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEDLFESIDKLISAGINAGDVKKLQDAGIYTCNGLMMHTK 63 >ref|XP_012487202.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X1 [Gossypium raimondii] Length = 349 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEED ESI KLIS +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEDLFESIDKLISAGINAGDVKKLQDAGIYTCNGLMMHTK 63 >gb|KJB38194.1| hypothetical protein B456_006G243000 [Gossypium raimondii] Length = 344 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEED ESI KLIS +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEDLFESIDKLISAGINAGDVKKLQDAGIYTCNGLMMHTK 63 >gb|KJB38193.1| hypothetical protein B456_006G243000 [Gossypium raimondii] Length = 342 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEED ESI KLIS +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEDLFESIDKLISAGINAGDVKKLQDAGIYTCNGLMMHTK 63 >ref|XP_010239525.1| PREDICTED: meiotic recombination protein DMC1 homolog [Brachypodium distachyon] Length = 346 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -3 Query: 248 MHDEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMKLS 114 + +EE+ ESI KLISQ +AGDV LQDAGIYTCN LMMH K S Sbjct: 22 VEEEEECFESIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTKKS 66 >ref|XP_010061767.1| PREDICTED: meiotic recombination protein DMC1 homolog [Eucalyptus grandis] Length = 344 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -3 Query: 242 DEEDYLESIIKLISQRTSAGDVMNLQDAGIYTCNALMMHMK 120 DEED ++I KLISQ +AGDV LQDAGIYTCN LMMH K Sbjct: 23 DEEDLFQTIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTK 63