BLASTX nr result
ID: Ophiopogon21_contig00015662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00015662 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010931913.1| PREDICTED: probable ADP-ribosylation factor ... 56 9e-06 >ref|XP_010931913.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD5 [Elaeis guineensis] Length = 545 Score = 56.2 bits (134), Expect = 9e-06 Identities = 36/104 (34%), Positives = 50/104 (48%), Gaps = 7/104 (6%) Frame = -1 Query: 323 NGDLPAQNWPNLVYQMPVITSTGVQKDADKFSQAGSILPS-PTMTYSHHPTLNTQTVGLA 147 +G+LPAQ WPNL YQ+P ++ Q + + +Q G+I + P+ +S PT + GL+ Sbjct: 442 DGNLPAQIWPNLGYQVPGVSPLAGQPNTNMLNQIGNISQAHPSGNFSPLPTSSMYAAGLS 501 Query: 146 APVNEAPTAEA------CKPXXXXXXXXXXXXXXXXXLGMFSKH 33 APVN A T A P GMFSKH Sbjct: 502 APVNGATTGGARRNSTSSSPSTTPNQSFSDYDFSSLTQGMFSKH 545