BLASTX nr result
ID: Ophiopogon21_contig00014855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00014855 (460 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520485.1| conserved hypothetical protein [Ricinus comm... 56 9e-06 >ref|XP_002520485.1| conserved hypothetical protein [Ricinus communis] gi|223540327|gb|EEF41898.1| conserved hypothetical protein [Ricinus communis] Length = 160 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/84 (36%), Positives = 42/84 (50%), Gaps = 3/84 (3%) Frame = -2 Query: 306 SQGKAGKTPQKSGNAVVFCEVSEPCSMSSSVDYGCRDNYYPNPPTNHQTGSVXXXXXXXX 127 S+ + P K N+ + E EPC +SSS+ YG +DN Y PP++ +GS Sbjct: 78 SEAASYNMPNKDRNSTLMEERGEPCHLSSSLYYGGQDN-YSQPPSSRNSGSYPIFKKDGV 136 Query: 126 XXXXXXXEN---SRGEWWQGSLYY 64 + SRG WWQGSLYY Sbjct: 137 DDDPNGNNSNGASRGNWWQGSLYY 160