BLASTX nr result
ID: Ophiopogon21_contig00014588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00014588 (353 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997... 82 1e-13 ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610... 81 3e-13 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 81 3e-13 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 80 6e-13 ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968... 79 1e-12 ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595... 79 2e-12 ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973... 79 2e-12 ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247... 78 2e-12 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 78 3e-12 ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703... 78 3e-12 ref|XP_008792809.1| PREDICTED: uncharacterized protein LOC103709... 77 4e-12 ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165... 77 5e-12 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 77 5e-12 ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104... 77 5e-12 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 77 5e-12 ref|XP_009394699.1| PREDICTED: uncharacterized protein LOC103980... 77 6e-12 ref|XP_009404012.1| PREDICTED: uncharacterized protein LOC103987... 76 8e-12 ref|XP_014504913.1| PREDICTED: uncharacterized protein LOC106764... 76 1e-11 ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179... 76 1e-11 ref|XP_009418465.1| PREDICTED: uncharacterized protein LOC103998... 76 1e-11 >ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997494 [Musa acuminata subsp. malaccensis] Length = 41 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF Sbjct: 1 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 40 >ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610579 [Nelumbo nucifera] Length = 41 Score = 81.3 bits (199), Expect = 3e-13 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSPILSEILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] Length = 41 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSP+LSEILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] gi|944057566|gb|KQJ93156.1| hypothetical protein BRADI_3g02990 [Brachypodium distachyon] Length = 41 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSP++SEILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968797 [Musa acuminata subsp. malaccensis] Length = 41 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSPILSEILL GFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPILSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595623 [Nelumbo nucifera] Length = 41 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSPI+SEILLSGFMINS+LRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPIVSEILLSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973592 [Musa acuminata subsp. malaccensis] Length = 41 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSP+LSEIL SGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILRSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247207 [Vitis vinifera] Length = 41 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSP+LSE+L SGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEVLRSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 M+P+L EILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703760 [Phoenix dactylifera] gi|672144149|ref|XP_008795970.1| PREDICTED: uncharacterized protein LOC103711555 [Phoenix dactylifera] Length = 41 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSPILSEILLSGFMI+S+LRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPILSEILLSGFMISSSLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_008792809.1| PREDICTED: uncharacterized protein LOC103709303 [Phoenix dactylifera] Length = 92 Score = 77.4 bits (189), Expect = 4e-12 Identities = 40/63 (63%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF-XXXXXXXXXSGPCLFLHIN 74 MSPILSEI LSGFMINST R +HLVQSFSVVFLYWFYVF G C +H++ Sbjct: 1 MSPILSEIFLSGFMINSTFRHPTHLVQSFSVVFLYWFYVFSRGVSSSISVLGHCPLVHLH 60 Query: 73 NFL 65 N L Sbjct: 61 NLL 63 >ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165758 [Sesamum indicum] Length = 43 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 253 LMSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 +MS +LSEILLSGF +NSTLRRRSHLVQSFSVVFLYWFYVF Sbjct: 2 IMSAVLSEILLSGFTVNSTLRRRSHLVQSFSVVFLYWFYVF 42 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] Length = 45 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -2 Query: 259 F*LMSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 F +MSP++SE+LLSGF INSTL RR+HLVQSFSVVFLYWFYVF Sbjct: 2 FGIMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVF 44 >ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104584 [Nicotiana tomentosiformis] Length = 45 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -2 Query: 259 F*LMSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 F +MSP++SE+LLSGF INSTL RR+HLVQSFSVVFLYWFYVF Sbjct: 2 FEIMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVF 44 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|593795374|ref|XP_007160725.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|731312172|ref|XP_010672909.1| PREDICTED: uncharacterized protein LOC104889396 [Beta vulgaris subsp. vulgaris] gi|747073329|ref|XP_011083620.1| PREDICTED: uncharacterized protein LOC105166091 [Sesamum indicum] gi|802595010|ref|XP_012071924.1| PREDICTED: uncharacterized protein LOC105633842 [Jatropha curcas] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|870869972|gb|KMT20717.1| hypothetical protein BVRB_1g006920 [Beta vulgaris subsp. vulgaris] gi|947066007|gb|KRH15150.1| hypothetical protein GLYMA_14G071500 [Glycine max] Length = 41 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSP+LSEIL SGFMINS+LRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_009394699.1| PREDICTED: uncharacterized protein LOC103980141 [Musa acuminata subsp. malaccensis] Length = 57 Score = 76.6 bits (187), Expect = 6e-12 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVFXXXXXXXXXSGP 95 MSPILSEILLSG MINST+R R+HLVQSFSVVFLYWFYVF SGP Sbjct: 1 MSPILSEILLSGCMINSTIRHRTHLVQSFSVVFLYWFYVFSELVLRSEHSGP 52 >ref|XP_009404012.1| PREDICTED: uncharacterized protein LOC103987431 [Musa acuminata subsp. malaccensis] Length = 41 Score = 76.3 bits (186), Expect = 8e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MS ILSEILLSGFMI+STLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSAILSEILLSGFMISSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_014504913.1| PREDICTED: uncharacterized protein LOC106764966 [Vigna radiata var. radiata] Length = 41 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSP+LSEIL SGFMINS+LRRR+HLVQSFSV+FLYWFYVF Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVLFLYWFYVF 40 >ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179060 [Sesamum indicum] Length = 41 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSP+LSEILLSGF +NS+L RRSHLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILLSGFTVNSSLHRRSHLVQSFSVVFLYWFYVF 40 >ref|XP_009418465.1| PREDICTED: uncharacterized protein LOC103998657 [Musa acuminata subsp. malaccensis] Length = 41 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 250 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 131 MSPILSEILL GFMINS+LRRR+HLVQSFSVVFL+WFYVF Sbjct: 1 MSPILSEILLCGFMINSSLRRRTHLVQSFSVVFLHWFYVF 40