BLASTX nr result
ID: Ophiopogon21_contig00013703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00013703 (493 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846022.1| PREDICTED: 30-kDa cleavage and polyadenylati... 60 6e-07 >ref|XP_006846022.1| PREDICTED: 30-kDa cleavage and polyadenylation specificity factor 30 [Amborella trichopoda] gi|548848778|gb|ERN07697.1| hypothetical protein AMTR_s00155p00079840 [Amborella trichopoda] Length = 701 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -1 Query: 472 NDESESEDEAAPRRSRYGDGKKKRLESDREA-GSDQWETPVAEVQN 338 NDESESEDE APRRSR+G+G+KKR E D E SD WE P++E QN Sbjct: 656 NDESESEDE-APRRSRHGEGRKKRREPDGEGEASDHWEMPLSEQQN 700