BLASTX nr result
ID: Ophiopogon21_contig00012886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00012886 (669 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] ... 84 8e-14 ref|XP_012450509.1| PREDICTED: 50S ribosomal protein L34, chloro... 84 1e-13 ref|XP_012445398.1| PREDICTED: 50S ribosomal protein L34, chloro... 84 1e-13 ref|XP_002274637.2| PREDICTED: 50S ribosomal protein L34, chloro... 83 1e-13 ref|XP_008439748.1| PREDICTED: 50S ribosomal protein L34, chloro... 83 1e-13 emb|CBI30669.3| unnamed protein product [Vitis vinifera] 83 1e-13 ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloro... 83 1e-13 emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] 83 1e-13 ref|XP_010277750.1| PREDICTED: 50S ribosomal protein L34, chloro... 83 2e-13 ref|XP_009386293.1| PREDICTED: 50S ribosomal protein L34, chloro... 83 2e-13 gb|KHG06612.1| 50S ribosomal protein L34, chloroplastic [Gossypi... 82 2e-13 gb|KHG06610.1| 50S ribosomal protein L34, chloroplastic [Gossypi... 82 2e-13 ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloro... 82 2e-13 ref|XP_008225220.1| PREDICTED: 50S ribosomal protein L34, chloro... 82 3e-13 ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prun... 82 3e-13 ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precu... 82 4e-13 ref|XP_009352789.1| PREDICTED: 50S ribosomal protein L34, chloro... 80 8e-13 ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Popu... 80 8e-13 ref|XP_009352788.1| PREDICTED: 50S ribosomal protein L34, chloro... 80 1e-12 ref|XP_009348496.1| PREDICTED: 50S ribosomal protein L34, chloro... 80 1e-12 >ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] gi|508780782|gb|EOY28038.1| 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 84.0 bits (206), Expect = 8e-14 Identities = 45/62 (72%), Positives = 46/62 (74%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNPNSGK Sbjct: 97 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 156 Query: 286 RA 281 R+ Sbjct: 157 RS 158 >ref|XP_012450509.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Gossypium raimondii] gi|763796287|gb|KJB63242.1| hypothetical protein B456_010G1587002 [Gossypium raimondii] Length = 153 Score = 83.6 bits (205), Expect = 1e-13 Identities = 45/61 (73%), Positives = 45/61 (73%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNPNSGK Sbjct: 93 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 152 Query: 286 R 284 R Sbjct: 153 R 153 >ref|XP_012445398.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium raimondii] gi|763790434|gb|KJB57430.1| hypothetical protein B456_009G163700 [Gossypium raimondii] Length = 157 Score = 83.6 bits (205), Expect = 1e-13 Identities = 45/61 (73%), Positives = 45/61 (73%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNPNSGK Sbjct: 97 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 156 Query: 286 R 284 R Sbjct: 157 R 157 >ref|XP_002274637.2| PREDICTED: 50S ribosomal protein L34, chloroplastic [Vitis vinifera] Length = 174 Score = 83.2 bits (204), Expect = 1e-13 Identities = 45/62 (72%), Positives = 46/62 (74%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNP+SGK Sbjct: 113 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGK 172 Query: 286 RA 281 RA Sbjct: 173 RA 174 >ref|XP_008439748.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Cucumis melo] Length = 155 Score = 83.2 bits (204), Expect = 1e-13 Identities = 45/62 (72%), Positives = 46/62 (74%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNP+SGK Sbjct: 94 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTNGRAVLKRRRAKGRKVLCTKSNPSSGK 153 Query: 286 RA 281 RA Sbjct: 154 RA 155 >emb|CBI30669.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 83.2 bits (204), Expect = 1e-13 Identities = 45/62 (72%), Positives = 46/62 (74%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNP+SGK Sbjct: 52 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGK 111 Query: 286 RA 281 RA Sbjct: 112 RA 113 >ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Cucumis sativus] gi|700194094|gb|KGN49298.1| hypothetical protein Csa_6G519510 [Cucumis sativus] Length = 155 Score = 83.2 bits (204), Expect = 1e-13 Identities = 45/62 (72%), Positives = 46/62 (74%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNP+SGK Sbjct: 94 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTNGRAVLKRRRAKGRKVLCTKSNPSSGK 153 Query: 286 RA 281 RA Sbjct: 154 RA 155 >emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] Length = 148 Score = 83.2 bits (204), Expect = 1e-13 Identities = 45/62 (72%), Positives = 46/62 (74%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNP+SGK Sbjct: 87 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGK 146 Query: 286 RA 281 RA Sbjct: 147 RA 148 >ref|XP_010277750.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Nelumbo nucifera] Length = 150 Score = 82.8 bits (203), Expect = 2e-13 Identities = 45/62 (72%), Positives = 45/62 (72%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLC KSNPNSGK Sbjct: 89 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCPKSNPNSGK 148 Query: 286 RA 281 RA Sbjct: 149 RA 150 >ref|XP_009386293.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Musa acuminata subsp. malaccensis] Length = 148 Score = 82.8 bits (203), Expect = 2e-13 Identities = 44/63 (69%), Positives = 47/63 (74%) Frame = -3 Query: 469 QVRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSG 290 QVRAGKA LC TKR+RSRKSLA RAV++RRRAKGRKVLCTKSNPNSG Sbjct: 86 QVRAGKAALCTTKRSRSRKSLARTHGFRRRMRTPSGRAVIRRRRAKGRKVLCTKSNPNSG 145 Query: 289 KRA 281 KRA Sbjct: 146 KRA 148 >gb|KHG06612.1| 50S ribosomal protein L34, chloroplastic [Gossypium arboreum] Length = 250 Score = 82.4 bits (202), Expect = 2e-13 Identities = 44/61 (72%), Positives = 45/61 (73%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RA+LKRRRAKGRKVLCTKSNPNSGK Sbjct: 190 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRALLKRRRAKGRKVLCTKSNPNSGK 249 Query: 286 R 284 R Sbjct: 250 R 250 >gb|KHG06610.1| 50S ribosomal protein L34, chloroplastic [Gossypium arboreum] Length = 442 Score = 82.4 bits (202), Expect = 2e-13 Identities = 44/61 (72%), Positives = 45/61 (73%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RA+LKRRRAKGRKVLCTKSNPNSGK Sbjct: 382 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRALLKRRRAKGRKVLCTKSNPNSGK 441 Query: 286 R 284 R Sbjct: 442 R 442 >ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Fragaria vesca subsp. vesca] Length = 150 Score = 82.4 bits (202), Expect = 2e-13 Identities = 43/62 (69%), Positives = 47/62 (75%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC+TKRN+SRKSLA RA+LKRRRAKGRKVLCTK+NPNSGK Sbjct: 89 VRAGKAALCLTKRNKSRKSLARTHGFRRRMRTTSGRAMLKRRRAKGRKVLCTKTNPNSGK 148 Query: 286 RA 281 RA Sbjct: 149 RA 150 >ref|XP_008225220.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Prunus mume] Length = 99 Score = 82.0 bits (201), Expect = 3e-13 Identities = 42/62 (67%), Positives = 47/62 (75%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC+TKRNRSRKSLA RA+LKRRRAKGR++LCTK+NPNSGK Sbjct: 38 VRAGKAALCLTKRNRSRKSLARTHGFRRRMRTTGGRAMLKRRRAKGRRILCTKTNPNSGK 97 Query: 286 RA 281 RA Sbjct: 98 RA 99 >ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] gi|462407923|gb|EMJ13257.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] Length = 209 Score = 82.0 bits (201), Expect = 3e-13 Identities = 42/62 (67%), Positives = 47/62 (75%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 V+AGKA LC+TKRNRSRKSLA RA+LKRRRAKGRK+LCTK+NPNSGK Sbjct: 148 VKAGKAALCLTKRNRSRKSLARTHGFRRRMRTTGGRAMLKRRRAKGRKILCTKTNPNSGK 207 Query: 286 RA 281 RA Sbjct: 208 RA 209 >ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] gi|223538249|gb|EEF39858.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] Length = 161 Score = 81.6 bits (200), Expect = 4e-13 Identities = 44/60 (73%), Positives = 44/60 (73%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC TKRNRSRKSLA RAVLKRRRAKGRKVLCTKSNPNSGK Sbjct: 100 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 159 >ref|XP_009352789.1| PREDICTED: 50S ribosomal protein L34, chloroplastic isoform X2 [Pyrus x bretschneideri] Length = 152 Score = 80.5 bits (197), Expect = 8e-13 Identities = 42/62 (67%), Positives = 46/62 (74%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC+TKR+RSRKSLA RA++KRRRAKGRKVLCTKSNPN GK Sbjct: 91 VRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTGGRAMMKRRRAKGRKVLCTKSNPNGGK 150 Query: 286 RA 281 RA Sbjct: 151 RA 152 >ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] gi|550327876|gb|EEE98039.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] Length = 160 Score = 80.5 bits (197), Expect = 8e-13 Identities = 43/60 (71%), Positives = 45/60 (75%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC+TKR+RSRKSLA RAVLKRRRAKGRKVLCTKSNPNSGK Sbjct: 99 VRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 158 >ref|XP_009352788.1| PREDICTED: 50S ribosomal protein L34, chloroplastic isoform X1 [Pyrus x bretschneideri] Length = 152 Score = 80.1 bits (196), Expect = 1e-12 Identities = 42/62 (67%), Positives = 47/62 (75%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC+TKR+RSRKSLA RA++KRRRAKGRKVLCTKSNP+SGK Sbjct: 91 VRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTGGRAMMKRRRAKGRKVLCTKSNPSSGK 150 Query: 286 RA 281 RA Sbjct: 151 RA 152 >ref|XP_009348496.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Pyrus x bretschneideri] Length = 152 Score = 80.1 bits (196), Expect = 1e-12 Identities = 42/62 (67%), Positives = 47/62 (75%) Frame = -3 Query: 466 VRAGKAVLCMTKRNRSRKSLAXXXXXXXXXXXXXXRAVLKRRRAKGRKVLCTKSNPNSGK 287 VRAGKA LC+TKR+RSRKSLA RA++KRRRAKGRKVLCTKSNP+SGK Sbjct: 91 VRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTGGRAMMKRRRAKGRKVLCTKSNPSSGK 150 Query: 286 RA 281 RA Sbjct: 151 RA 152