BLASTX nr result
ID: Ophiopogon21_contig00012313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00012313 (451 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009414475.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-16 ref|XP_010910211.1| PREDICTED: pentatricopeptide repeat-containi... 90 6e-16 ref|XP_008776153.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 ref|XP_006491485.1| PREDICTED: conserved oligomeric Golgi comple... 72 3e-11 gb|KDO86622.1| hypothetical protein CISIN_1g012126mg [Citrus sin... 72 3e-11 ref|XP_008463091.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-11 ref|XP_011080709.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-10 ref|XP_006444724.1| hypothetical protein CICLE_v10023955mg, part... 72 2e-10 ref|XP_010270410.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_008361935.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_008353196.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_004138384.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 gb|KQL25447.1| hypothetical protein SETIT_031917mg, partial [Set... 69 1e-09 gb|KQL23025.1| hypothetical protein SETIT_031929mg, partial [Set... 69 1e-09 emb|CDO98642.1| unnamed protein product [Coffea canephora] 69 1e-09 ref|XP_004957457.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_004955823.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_007051427.1| Pentatricopeptide repeat-containing protein,... 64 1e-09 ref|XP_011468889.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 emb|CAN72416.1| hypothetical protein VITISV_027905 [Vitis vinifera] 67 1e-09 >ref|XP_009414475.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 449 Score = 85.9 bits (211), Expect(2) = 4e-16 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGICVD 289 GL+PHFSVFH L+KGFC +GKVDEAC+VLE ML GV+PH++TW V+G+C D Sbjct: 349 GLVPHFSVFHALVKGFCSVGKVDEACRVLETMLTKGVAPHVETWDLLVAGVCDD 402 Score = 25.4 bits (54), Expect(2) = 4e-16 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 208 DEKAWPRGTRILEIGSGLE 152 +E+ W R TR +++G GLE Sbjct: 416 NEEEWRRSTRHIQVGCGLE 434 >ref|XP_010910211.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Elaeis guineensis] Length = 458 Score = 90.1 bits (222), Expect = 6e-16 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 GL+PHFSVFH LIKGFCG+GKVDEAC+VLE MLR GV+PH+DTW V+G+C Sbjct: 355 GLVPHFSVFHALIKGFCGVGKVDEACRVLEGMLRQGVAPHVDTWDLIVAGVC 406 >ref|XP_008776153.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Phoenix dactylifera] Length = 460 Score = 80.5 bits (197), Expect = 5e-13 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 GL+ HFSVFH LIKGFCG+GKV EAC VLE MLR G++PH+DTW V+G+C Sbjct: 360 GLVLHFSVFHALIKGFCGVGKVVEACHVLEGMLRQGMAPHVDTWDLMVAGVC 411 >ref|XP_006491485.1| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Citrus sinensis] Length = 1352 Score = 72.0 bits (175), Expect(2) = 3e-11 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H LIKGFC +GKVDEAC VLE +L++G +PH DTW V IC Sbjct: 371 GFSPHFSVSHALIKGFCNVGKVDEACGVLEELLKAGEAPHEDTWVMIVPQIC 422 Score = 22.7 bits (47), Expect(2) = 3e-11 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 184 TRILEIGSGLEQRNITRMKSR 122 TRI+E G GLE I + +SR Sbjct: 446 TRIVEAGIGLEDYLIGKTRSR 466 >gb|KDO86622.1| hypothetical protein CISIN_1g012126mg [Citrus sinensis] Length = 470 Score = 72.0 bits (175), Expect(2) = 3e-11 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H LIKGFC +GKVDEAC VLE +L++G +PH DTW V IC Sbjct: 371 GFSPHFSVSHALIKGFCNVGKVDEACGVLEELLKAGEAPHEDTWVMIVPQIC 422 Score = 22.7 bits (47), Expect(2) = 3e-11 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 184 TRILEIGSGLEQRNITRMKSR 122 TRI+E G GLE I + +SR Sbjct: 446 TRIVEAGIGLEDYLIGKTRSR 466 >ref|XP_008463091.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Cucumis melo] Length = 481 Score = 70.5 bits (171), Expect(2) = 6e-11 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H L+KGF +G++DE+C VLE ML+ G +PH DTW +SGIC Sbjct: 381 GFYPHFSVIHALVKGFHNVGRMDESCSVLEGMLKHGKAPHSDTWEIIISGIC 432 Score = 23.1 bits (48), Expect(2) = 6e-11 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -1 Query: 190 RGTRILEIGSGLEQRNITRMKSRK 119 R TRI+E G+GL + I ++++ K Sbjct: 454 RDTRIVEAGTGLGEYLIRKLQASK 477 >ref|XP_011080709.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Sesamum indicum] gi|747067934|ref|XP_011080710.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Sesamum indicum] gi|747067936|ref|XP_011080711.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Sesamum indicum] Length = 460 Score = 67.8 bits (164), Expect(2) = 1e-10 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H L+KGFC +GK ++AC+VL +LR G SPH DTW + IC Sbjct: 363 GFCPHFSVVHLLVKGFCKIGKAEDACEVLFELLRHGNSPHADTWAEILPSIC 414 Score = 25.0 bits (53), Expect(2) = 1e-10 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = -1 Query: 184 TRILEIGSGLEQRNITRMKSR 122 TRI+++G+GLE I ++K+R Sbjct: 436 TRIVDLGAGLEDYLIKKIKAR 456 >ref|XP_006444724.1| hypothetical protein CICLE_v10023955mg, partial [Citrus clementina] gi|557546986|gb|ESR57964.1| hypothetical protein CICLE_v10023955mg, partial [Citrus clementina] Length = 423 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H LIKGFC +GKVDEAC VLE +L++G +PH DTW V IC Sbjct: 371 GFSPHFSVSHALIKGFCNVGKVDEACGVLEELLKAGEAPHEDTWVMIVPQIC 422 >ref|XP_010270410.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Nelumbo nucifera] gi|720046141|ref|XP_010270411.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Nelumbo nucifera] gi|720046144|ref|XP_010270412.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Nelumbo nucifera] gi|720046148|ref|XP_010270413.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Nelumbo nucifera] gi|720046151|ref|XP_010270414.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Nelumbo nucifera] gi|720046154|ref|XP_010270415.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Nelumbo nucifera] gi|720046157|ref|XP_010270416.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Nelumbo nucifera] Length = 464 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSVFH L+KGFC +GK++EAC+VL MLR G +PH DTW V IC Sbjct: 365 GFSPHFSVFHALVKGFCIVGKMEEACEVLGEMLRHGEAPHTDTWVEIVPRIC 416 >ref|XP_008361935.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Malus domestica] Length = 457 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H L+KGFC +G+V+EAC VLE +L+ G PH DTW V GIC Sbjct: 357 GFSPHFSVIHALVKGFCNVGRVEEACGVLEEVLKHGEVPHTDTWITVVPGIC 408 >ref|XP_008353196.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Malus domestica] Length = 457 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H L+KGFC +G+V+EAC VLE +L+ G PH DTW V GIC Sbjct: 357 GFSPHFSVIHALVKGFCNVGRVEEACGVLEEVLKHGEVPHTDTWITVVPGIC 408 >ref|XP_004138384.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Cucumis sativus] gi|700190654|gb|KGN45858.1| hypothetical protein Csa_6G014780 [Cucumis sativus] Length = 482 Score = 68.9 bits (167), Expect(2) = 5e-10 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H L+KGF +G++ E+C VLE ML+ G +PH DTW +SGIC Sbjct: 382 GFYPHFSVIHALVKGFHSIGRIHESCSVLEDMLKRGKAPHSDTWEIIISGIC 433 Score = 21.6 bits (44), Expect(2) = 5e-10 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -1 Query: 190 RGTRILEIGSGLEQRNITRMKS 125 R TRI+E G+GL + I ++++ Sbjct: 455 RDTRIVEAGTGLGEYLIRKLQA 476 >gb|KQL25447.1| hypothetical protein SETIT_031917mg, partial [Setaria italica] Length = 386 Score = 69.3 bits (168), Expect = 1e-09 Identities = 27/54 (50%), Positives = 42/54 (77%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGICVD 289 GL+PHFS+FH +IKG+CG+GKV+EA +++ ML GV+PH+++W + +C D Sbjct: 322 GLVPHFSLFHSVIKGYCGVGKVEEAAQIMTWMLDLGVTPHVESWSSVIRCVCND 375 >gb|KQL23025.1| hypothetical protein SETIT_031929mg, partial [Setaria italica] Length = 381 Score = 69.3 bits (168), Expect = 1e-09 Identities = 27/54 (50%), Positives = 42/54 (77%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGICVD 289 GL+PHFS+FH +IKG+CG+GKV+EA +++ ML GV+PH+++W + +C D Sbjct: 302 GLVPHFSLFHSVIKGYCGVGKVEEAAQIMTWMLDLGVTPHVESWSSVIRCVCND 355 >emb|CDO98642.1| unnamed protein product [Coffea canephora] Length = 357 Score = 69.3 bits (168), Expect = 1e-09 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTW 319 G PH+S+ H L+KGFC +GK +EAC VLE +LR GV+PH+DTW Sbjct: 258 GFSPHYSIVHLLVKGFCNIGKFEEACAVLEEVLRHGVAPHIDTW 301 >ref|XP_004957457.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Setaria italica] Length = 401 Score = 69.3 bits (168), Expect = 1e-09 Identities = 27/54 (50%), Positives = 42/54 (77%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGICVD 289 GL+PHFS+FH +IKG+CG+GKV+EA +++ ML GV+PH+++W + +C D Sbjct: 322 GLVPHFSLFHSVIKGYCGVGKVEEAAQIMTWMLDLGVTPHVESWSSVIRCVCND 375 >ref|XP_004955823.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Setaria italica] Length = 401 Score = 69.3 bits (168), Expect = 1e-09 Identities = 27/54 (50%), Positives = 42/54 (77%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGICVD 289 GL+PHFS+FH +IKG+CG+GKV+EA +++ ML GV+PH+++W + +C D Sbjct: 322 GLVPHFSLFHSVIKGYCGVGKVEEAAQIMTWMLDLGVTPHVESWSSVIRCVCND 375 >ref|XP_007051427.1| Pentatricopeptide repeat-containing protein, mitochondrial [Theobroma cacao] gi|508703688|gb|EOX95584.1| Pentatricopeptide repeat-containing protein, mitochondrial [Theobroma cacao] Length = 461 Score = 63.9 bits (154), Expect(2) = 1e-09 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGICVD 289 G PHFSV H L+KGFC +GK++EA V ML+ G PH+DTW + IC D Sbjct: 362 GFSPHFSVSHTLVKGFCNVGKIEEAIGVFGEMLKYGEVPHMDTWVLIIPRICED 415 Score = 25.4 bits (54), Expect(2) = 1e-09 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 190 RGTRILEIGSGLEQRNITRMKSR 122 R TRI++ G+GLE I +++SR Sbjct: 435 RDTRIVDAGTGLEDYLIRKIRSR 457 >ref|XP_011468889.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 452 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSV H L+KGFC +G++++AC V+E +LR G PH DTW + GIC Sbjct: 352 GFSPHFSVVHGLVKGFCNVGRIEDACGVMEEILRHGEVPHRDTWITIIPGIC 403 >emb|CAN72416.1| hypothetical protein VITISV_027905 [Vitis vinifera] Length = 422 Score = 67.0 bits (162), Expect(2) = 1e-09 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -2 Query: 450 GLMPHFSVFHKLIKGFCGLGKVDEACKVLELMLRSGVSPHLDTWXXXVSGIC 295 G PHFSVFH LI GFC +GK++EAC+VL MLR G + H +TW + IC Sbjct: 323 GFSPHFSVFHALINGFCNVGKLEEACEVLXEMLRHGEAXHTETWVAIIPRIC 374 Score = 21.9 bits (45), Expect(2) = 1e-09 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -1 Query: 184 TRILEIGSGLEQRNI--TRMKSRK 119 TR++E G GLE+ I R KSRK Sbjct: 398 TRLVEAGIGLEEYVIRKVRDKSRK 421