BLASTX nr result
ID: Ophiopogon21_contig00009297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00009297 (511 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009384254.1| PREDICTED: basic leucine zipper and W2 domai... 73 7e-11 ref|XP_009383336.1| PREDICTED: basic leucine zipper and W2 domai... 73 7e-11 gb|KMZ58733.1| Basic leucine zipper and W2 domain-containing pro... 71 4e-10 ref|XP_010241522.1| PREDICTED: basic leucine zipper and W2 domai... 71 4e-10 ref|XP_010927633.1| PREDICTED: basic leucine zipper and W2 domai... 70 5e-10 ref|XP_008787734.1| PREDICTED: basic leucine zipper and W2 domai... 70 5e-10 ref|XP_012476913.1| PREDICTED: basic leucine zipper and W2 domai... 70 6e-10 ref|XP_010926617.1| PREDICTED: basic leucine zipper and W2 domai... 70 6e-10 gb|KHG11883.1| Basic leucine zipper and W2 domain-containing 2 [... 70 6e-10 ref|XP_014498019.1| PREDICTED: basic leucine zipper and W2 domai... 69 1e-09 gb|KOM37015.1| hypothetical protein LR48_Vigan03g039600 [Vigna a... 69 1e-09 ref|XP_011006974.1| PREDICTED: basic leucine zipper and W2 domai... 69 1e-09 gb|KHG20905.1| Basic leucine zipper and W2 domain-containing 2 [... 69 1e-09 ref|XP_008370829.1| PREDICTED: basic leucine zipper and W2 domai... 69 1e-09 ref|XP_008370828.1| PREDICTED: basic leucine zipper and W2 domai... 69 1e-09 ref|XP_012085767.1| PREDICTED: basic leucine zipper and W2 domai... 69 1e-09 ref|XP_002514839.1| translation initiation factor, putative [Ric... 69 1e-09 ref|XP_007029311.1| ARM repeat superfamily protein isoform 2 [Th... 69 1e-09 ref|XP_007029310.1| ARM repeat superfamily protein isoform 1 [Th... 69 1e-09 ref|XP_004492841.1| PREDICTED: basic leucine zipper and W2 domai... 69 1e-09 >ref|XP_009384254.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Musa acuminata subsp. malaccensis] Length = 411 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 404 >ref|XP_009383336.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Musa acuminata subsp. malaccensis] Length = 411 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 404 >gb|KMZ58733.1| Basic leucine zipper and W2 domain-containing protein [Zostera marina] Length = 412 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTILLWFRKGANPKGRQTFVKALEPFV WL Sbjct: 373 LAEDTILLWFRKGANPKGRQTFVKALEPFVKWL 405 >ref|XP_010241522.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Nelumbo nucifera] Length = 411 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTILLWFR+G+NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILLWFRRGSNPKGRQTFVKALEPFVNWL 404 >ref|XP_010927633.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Elaeis guineensis] Length = 411 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKGANPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGANPKGRQTFVKALEPFVNWL 404 >ref|XP_008787734.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Phoenix dactylifera] Length = 411 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKGANPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGANPKGRQTFVKALEPFVNWL 404 >ref|XP_012476913.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Gossypium raimondii] gi|763759519|gb|KJB26850.1| hypothetical protein B456_004G262900 [Gossypium raimondii] Length = 411 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG+NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILYWFRKGSNPKGRQTFVKALEPFVNWL 404 >ref|XP_010926617.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Elaeis guineensis] Length = 411 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDT+L WFRKGANPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTVLHWFRKGANPKGRQTFVKALEPFVNWL 404 >gb|KHG11883.1| Basic leucine zipper and W2 domain-containing 2 [Gossypium arboreum] Length = 411 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG+NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILYWFRKGSNPKGRQTFVKALEPFVNWL 404 >ref|XP_014498019.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Vigna radiata var. radiata] Length = 411 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 404 >gb|KOM37015.1| hypothetical protein LR48_Vigan03g039600 [Vigna angularis] Length = 442 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 403 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 435 >ref|XP_011006974.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Populus euphratica] Length = 411 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 404 >gb|KHG20905.1| Basic leucine zipper and W2 domain-containing 2 [Gossypium arboreum] Length = 422 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 383 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 415 >ref|XP_008370829.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2 isoform X2 [Malus domestica] Length = 411 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 404 >ref|XP_008370828.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2 isoform X1 [Malus domestica] Length = 412 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 373 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 405 >ref|XP_012085767.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Jatropha curcas] gi|643714209|gb|KDP26874.1| hypothetical protein JCGZ_18032 [Jatropha curcas] Length = 411 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 404 >ref|XP_002514839.1| translation initiation factor, putative [Ricinus communis] gi|223545890|gb|EEF47393.1| translation initiation factor, putative [Ricinus communis] Length = 411 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 404 >ref|XP_007029311.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao] gi|508717916|gb|EOY09813.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao] Length = 411 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 404 >ref|XP_007029310.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] gi|508717915|gb|EOY09812.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] Length = 414 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 375 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 407 >ref|XP_004492841.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Cicer arietinum] Length = 411 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 511 LAEDTILLWFRKGANPKGRQTFVKALEPFVNWL 413 LAEDTIL WFRKG NPKGRQTFVKALEPFVNWL Sbjct: 372 LAEDTILHWFRKGTNPKGRQTFVKALEPFVNWL 404