BLASTX nr result
ID: Ophiopogon21_contig00009052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00009052 (993 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009386925.1| PREDICTED: phospholipid-transporting ATPase ... 65 8e-08 ref|XP_002467910.1| hypothetical protein SORBIDRAFT_01g036200 [S... 60 4e-06 ref|XP_010938028.1| PREDICTED: phospholipid-transporting ATPase ... 59 6e-06 >ref|XP_009386925.1| PREDICTED: phospholipid-transporting ATPase 1-like [Musa acuminata subsp. malaccensis] gi|695079039|ref|XP_009386926.1| PREDICTED: phospholipid-transporting ATPase 1-like [Musa acuminata subsp. malaccensis] gi|695079041|ref|XP_009386927.1| PREDICTED: phospholipid-transporting ATPase 1-like [Musa acuminata subsp. malaccensis] gi|695079043|ref|XP_009386928.1| PREDICTED: phospholipid-transporting ATPase 1-like [Musa acuminata subsp. malaccensis] Length = 1319 Score = 65.1 bits (157), Expect = 8e-08 Identities = 43/105 (40%), Positives = 61/105 (58%), Gaps = 2/105 (1%) Frame = -3 Query: 310 AYTLEKKGYSKRQLYN-SDLSSTTDCLPSGELQFFESILVECPAPVGKLPVSWGSMELQG 134 A + E+ G+S+RQ+ + S+ S D L E +F E +EC G+ VSWG MELQG Sbjct: 60 AISFEESGFSQRQIVDVSNSSLNKDQLLWSESEFVEQSELECARQDGRQLVSWGVMELQG 119 Query: 133 FPPSFEISVANTGQEKVNKSQRIRPKS-TQXXXXXXXDTARLIYI 2 F S E+ +++ QEK++KSQ+I KS D +RLIYI Sbjct: 120 FSSSLEMPSSSSRQEKLDKSQQIHHKSLCPEEPCSAEDNSRLIYI 164 >ref|XP_002467910.1| hypothetical protein SORBIDRAFT_01g036200 [Sorghum bicolor] gi|241921764|gb|EER94908.1| hypothetical protein SORBIDRAFT_01g036200 [Sorghum bicolor] Length = 1311 Score = 59.7 bits (143), Expect = 4e-06 Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 2/103 (1%) Frame = -3 Query: 304 TLEKKGYSKRQLYNSDLSSTTDCLPSGELQFFESILVECPAPVGKLPVSWG-SMELQGFP 128 T E++ + SD+S + S + FF + VEC + VSWG +ME+Q P Sbjct: 57 TDEREAQPRHLRVESDVSRVAERFQSADSHFFHRLSVECSQEERQRKVSWGGAMEMQHSP 116 Query: 127 PSFEISVANTGQEKVNKSQRIRPKSTQ-XXXXXXXDTARLIYI 2 S EI + ++ EK N+SQRIR KS+Q RLIYI Sbjct: 117 SSLEIGMVSSSHEKPNRSQRIRNKSSQFEDPFLSEHEPRLIYI 159 >ref|XP_010938028.1| PREDICTED: phospholipid-transporting ATPase 1-like isoform X1 [Elaeis guineensis] gi|743843309|ref|XP_010938029.1| PREDICTED: phospholipid-transporting ATPase 1-like isoform X1 [Elaeis guineensis] Length = 1267 Score = 58.9 bits (141), Expect = 6e-06 Identities = 31/69 (44%), Positives = 42/69 (60%) Frame = -3 Query: 253 SSTTDCLPSGELQFFESILVECPAPVGKLPVSWGSMELQGFPPSFEISVANTGQEKVNKS 74 S ++ L + F L+ECP +L SW +MELQG+ S EISV + GQEK+NKS Sbjct: 39 SFSSSTLKDKQKYIFRQFLLECPQQERQL-ASWCTMELQGYSSSLEISVTSAGQEKLNKS 97 Query: 73 QRIRPKSTQ 47 ++R KS Q Sbjct: 98 HQVRHKSVQ 106