BLASTX nr result
ID: Ophiopogon21_contig00008567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00008567 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008673585.1| PREDICTED: zinc finger protein NUTCRACKER-li... 56 9e-06 ref|XP_002457187.1| hypothetical protein SORBIDRAFT_03g002960 [S... 56 9e-06 >ref|XP_008673585.1| PREDICTED: zinc finger protein NUTCRACKER-like [Zea mays] gi|414875861|tpg|DAA52992.1| TPA: hypothetical protein ZEAMMB73_513383 [Zea mays] Length = 497 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -3 Query: 241 HMSATALLQKAAQMGATLSRPAHLQEQMAPAHQSTTTDA 125 HMSATALLQKAAQMGATLSRP++ Q QMA H S+TT+A Sbjct: 348 HMSATALLQKAAQMGATLSRPSN-QGQMAGTHSSSTTNA 385 >ref|XP_002457187.1| hypothetical protein SORBIDRAFT_03g002960 [Sorghum bicolor] gi|241929162|gb|EES02307.1| hypothetical protein SORBIDRAFT_03g002960 [Sorghum bicolor] Length = 498 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -3 Query: 241 HMSATALLQKAAQMGATLSRPAHLQEQMAPAHQSTTTDAFGLNLA 107 HMSATALLQKAAQMGATLSRP++ Q QMA H +TTT G A Sbjct: 352 HMSATALLQKAAQMGATLSRPSN-QGQMASTHSTTTTTNAGTGAA 395