BLASTX nr result
ID: Ophiopogon21_contig00007341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00007341 (603 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012076625.1| PREDICTED: boron transporter 4 [Jatropha cur... 64 8e-08 ref|XP_012477099.1| PREDICTED: probable boron transporter 7 isof... 60 7e-07 ref|XP_012477098.1| PREDICTED: probable boron transporter 6 isof... 60 7e-07 ref|XP_009791278.1| PREDICTED: boron transporter 4-like [Nicotia... 59 2e-06 ref|XP_007013808.1| HCO3- transporter family [Theobroma cacao] g... 59 3e-06 ref|XP_009389934.1| PREDICTED: boron transporter 4-like isoform ... 58 3e-06 gb|KJB27046.1| hypothetical protein B456_004G274500 [Gossypium r... 57 6e-06 ref|XP_008809478.1| PREDICTED: boron transporter 4 [Phoenix dact... 57 6e-06 ref|XP_009588835.1| PREDICTED: probable boron transporter 7 [Nic... 57 8e-06 ref|XP_008447479.1| PREDICTED: boron transporter 4-like [Cucumis... 57 8e-06 ref|XP_002282436.1| PREDICTED: probable boron transporter 7 [Vit... 57 1e-05 emb|CAN78158.1| hypothetical protein VITISV_032799 [Vitis vinifera] 57 1e-05 >ref|XP_012076625.1| PREDICTED: boron transporter 4 [Jatropha curcas] Length = 660 Score = 63.5 bits (153), Expect = 8e-08 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -3 Query: 601 KERESSAEATDDVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAEP 449 +E + E T + + YDAEILD MTT RGELKLRT S +D+F Q+YP EP Sbjct: 608 RENDMENEVTSEDDFYDAEILDEMTTHRGELKLRTSSFKEDKFSQIYPQEP 658 >ref|XP_012477099.1| PREDICTED: probable boron transporter 7 isoform X2 [Gossypium raimondii] Length = 664 Score = 60.5 bits (145), Expect = 7e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -3 Query: 598 ERESSAEATDDVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAEP 449 E + AE TDD + +DAEILD MTTSRGELKLRT+S +DR QV+P P Sbjct: 613 ESSNGAEGTDD-DFHDAEILDEMTTSRGELKLRTKSYKEDRLYQVHPENP 661 >ref|XP_012477098.1| PREDICTED: probable boron transporter 6 isoform X1 [Gossypium raimondii] Length = 670 Score = 60.5 bits (145), Expect = 7e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -3 Query: 598 ERESSAEATDDVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAEP 449 E + AE TDD + +DAEILD MTTSRGELKLRT+S +DR QV+P P Sbjct: 619 ESSNGAEGTDD-DFHDAEILDEMTTSRGELKLRTKSYKEDRLYQVHPENP 667 >ref|XP_009791278.1| PREDICTED: boron transporter 4-like [Nicotiana sylvestris] Length = 669 Score = 59.3 bits (142), Expect = 2e-06 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = -3 Query: 595 RESSAEATDDVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAEP*LCTET 431 RE+ A +E DAEILD +TTSRGELK RT S ++D+ PQVYP E CTE+ Sbjct: 617 RETEATEEGKIEICDAEILDELTTSRGELKFRTVSFSEDKRPQVYPTEN--CTES 669 >ref|XP_007013808.1| HCO3- transporter family [Theobroma cacao] gi|508784171|gb|EOY31427.1| HCO3- transporter family [Theobroma cacao] Length = 666 Score = 58.5 bits (140), Expect = 3e-06 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 3/51 (5%) Frame = -3 Query: 601 KERE---SSAEATDDVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYP 458 KERE SS+E TDD + YDAEILD MTT+RGELKLRT S ++R QV+P Sbjct: 613 KEREPPDSSSEGTDD-DFYDAEILDEMTTNRGELKLRTVSFKEERLHQVHP 662 >ref|XP_009389934.1| PREDICTED: boron transporter 4-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 693 Score = 58.2 bits (139), Expect = 3e-06 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 601 KERESSAEATDD--VEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYP 458 KE E+S +DD VE DAEILD +TT RGELK R +S NDDRF QV+P Sbjct: 637 KEGEASTSDSDDGRVEVCDAEILDELTTHRGELKHRNKSFNDDRFHQVHP 686 >gb|KJB27046.1| hypothetical protein B456_004G274500 [Gossypium raimondii] Length = 673 Score = 57.4 bits (137), Expect = 6e-06 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -3 Query: 598 ERESSAEATDDVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVY 461 E + AE TDD + +DAEILD MTTSRGELKLRT+S +DR QVY Sbjct: 613 ESSNGAEGTDD-DFHDAEILDEMTTSRGELKLRTKSYKEDRLYQVY 657 >ref|XP_008809478.1| PREDICTED: boron transporter 4 [Phoenix dactylifera] Length = 681 Score = 57.4 bits (137), Expect = 6e-06 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = -3 Query: 598 ERESSAEATDDVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAE 452 E S A D E DAEILD +TTSRGELK+RT+S D++F QVYP E Sbjct: 627 EYSPSEGADSDHELCDAEILDELTTSRGELKIRTKSFTDEKFLQVYPEE 675 >ref|XP_009588835.1| PREDICTED: probable boron transporter 7 [Nicotiana tomentosiformis] Length = 195 Score = 57.0 bits (136), Expect = 8e-06 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 598 ERESSAEATDD--VEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAE 452 E E++ T++ +E DAEILD +TTSRGELK RT S ++D+ PQVYPAE Sbjct: 139 ETEATLPGTEEGKIEICDAEILDELTTSRGELKFRTVSFSEDKRPQVYPAE 189 >ref|XP_008447479.1| PREDICTED: boron transporter 4-like [Cucumis melo] Length = 669 Score = 57.0 bits (136), Expect = 8e-06 Identities = 27/53 (50%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -3 Query: 601 KERESS--AEATDDVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAEP 449 KE+ S+ ++ D+V+ DAEILD +TT RGELK+RT+S N+DR Q++P +P Sbjct: 614 KEKNSTHIVDSEDEVKICDAEILDELTTHRGELKVRTKSFNEDRHNQIHPDDP 666 >ref|XP_002282436.1| PREDICTED: probable boron transporter 7 [Vitis vinifera] gi|296081991|emb|CBI20996.3| unnamed protein product [Vitis vinifera] Length = 669 Score = 56.6 bits (135), Expect = 1e-05 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = -3 Query: 601 KERESSAEATD--DVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAE 452 +ERE + + D + +DAEILD MTT+RGELKLRT S N+DRF QV+P + Sbjct: 613 REREEAVPGSQGTDEDFFDAEILDEMTTNRGELKLRTVSFNEDRFFQVHPED 664 >emb|CAN78158.1| hypothetical protein VITISV_032799 [Vitis vinifera] Length = 637 Score = 56.6 bits (135), Expect = 1e-05 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = -3 Query: 601 KERESSAEATD--DVEAYDAEILDVMTTSRGELKLRTRSINDDRFPQVYPAE 452 +ERE + + D + +DAEILD MTT+RGELKLRT S N+DRF QV+P + Sbjct: 581 REREEAVPGSQGTDEDFFDAEILDEMTTNRGELKLRTVSFNEDRFFQVHPED 632