BLASTX nr result
ID: Ophiopogon21_contig00007178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00007178 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009385885.1| PREDICTED: WD repeat-containing protein 44-l... 86 1e-14 ref|XP_014504842.1| PREDICTED: WD repeat-containing protein 44 [... 85 2e-14 gb|KRH26070.1| hypothetical protein GLYMA_12G150300 [Glycine max] 85 2e-14 gb|KRH22132.1| hypothetical protein GLYMA_13G279400 [Glycine max] 85 2e-14 gb|KRH22131.1| hypothetical protein GLYMA_13G279400 [Glycine max] 85 2e-14 gb|KOM43644.1| hypothetical protein LR48_Vigan05g124900 [Vigna a... 85 2e-14 gb|KHN36799.1| WD repeat-containing protein 44 [Glycine soja] 85 2e-14 gb|KHN23456.1| WD repeat-containing protein 44 [Glycine soja] 85 2e-14 ref|XP_006592592.1| PREDICTED: WD repeat-containing protein 44-l... 85 2e-14 ref|XP_006592591.1| PREDICTED: WD repeat-containing protein 44-l... 85 2e-14 ref|XP_006592590.1| PREDICTED: WD repeat-containing protein 44-l... 85 2e-14 ref|XP_006592589.1| PREDICTED: WD repeat-containing protein 44-l... 85 2e-14 ref|XP_007149607.1| hypothetical protein PHAVU_005G083800g [Phas... 85 2e-14 ref|XP_003539589.1| PREDICTED: WD repeat-containing protein 44-l... 85 2e-14 ref|XP_011654077.1| PREDICTED: WD repeat-containing protein 44 i... 84 3e-14 ref|XP_009378485.1| PREDICTED: WD repeat-containing protein 44 [... 84 3e-14 ref|XP_008452481.1| PREDICTED: WD repeat-containing protein 44 i... 84 3e-14 ref|XP_008452480.1| PREDICTED: WD repeat-containing protein 44 i... 84 3e-14 ref|XP_008366762.1| PREDICTED: WD repeat-containing protein 44-l... 84 3e-14 ref|XP_007021341.1| Transducin/WD40 repeat-like superfamily prot... 84 3e-14 >ref|XP_009385885.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 938 Score = 85.9 bits (211), Expect = 1e-14 Identities = 43/74 (58%), Positives = 50/74 (67%), Gaps = 1/74 (1%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD-QDRPEPLR 297 VTCIQ N +D R +ISGSLDAKV IWS+P+ VVDWTDLHEMVT CYT D Q +P + Sbjct: 586 VTCIQFNPIDDRYFISGSLDAKVRIWSVPDRQVVDWTDLHEMVTAACYTPDGQVQPNDI- 644 Query: 298 AAMTVLHPADHKAS 339 +H HK S Sbjct: 645 ----CVHIGSHKGS 654 >ref|XP_014504842.1| PREDICTED: WD repeat-containing protein 44 [Vigna radiata var. radiata] Length = 788 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 461 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 511 >gb|KRH26070.1| hypothetical protein GLYMA_12G150300 [Glycine max] Length = 731 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 565 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 615 >gb|KRH22132.1| hypothetical protein GLYMA_13G279400 [Glycine max] Length = 824 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 463 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 513 >gb|KRH22131.1| hypothetical protein GLYMA_13G279400 [Glycine max] Length = 790 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 463 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 513 >gb|KOM43644.1| hypothetical protein LR48_Vigan05g124900 [Vigna angularis] Length = 352 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 25 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 75 >gb|KHN36799.1| WD repeat-containing protein 44 [Glycine soja] Length = 602 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 275 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 325 >gb|KHN23456.1| WD repeat-containing protein 44 [Glycine soja] Length = 825 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 499 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 549 >ref|XP_006592592.1| PREDICTED: WD repeat-containing protein 44-like isoform X4 [Glycine max] gi|571493572|ref|XP_006592593.1| PREDICTED: WD repeat-containing protein 44-like isoform X5 [Glycine max] Length = 711 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 565 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 615 >ref|XP_006592591.1| PREDICTED: WD repeat-containing protein 44-like isoform X3 [Glycine max] Length = 734 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 565 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 615 >ref|XP_006592590.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Glycine max] gi|947077231|gb|KRH26071.1| hypothetical protein GLYMA_12G150300 [Glycine max] gi|947077232|gb|KRH26072.1| hypothetical protein GLYMA_12G150300 [Glycine max] Length = 891 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 565 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 615 >ref|XP_006592589.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Glycine max] Length = 894 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 565 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 615 >ref|XP_007149607.1| hypothetical protein PHAVU_005G083800g [Phaseolus vulgaris] gi|561022871|gb|ESW21601.1| hypothetical protein PHAVU_005G083800g [Phaseolus vulgaris] Length = 782 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 455 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 505 >ref|XP_003539589.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max] gi|947078368|gb|KRH27208.1| hypothetical protein GLYMA_12G222100 [Glycine max] Length = 766 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP+ VVDWTDLHEMVT CYT D Sbjct: 439 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDRQVVDWTDLHEMVTAACYTPD 489 >ref|XP_011654077.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Cucumis sativus] Length = 886 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N +D R +ISGSLDAKV IWSIP++ VVDW+DLHEMVT CYT D Sbjct: 558 VTCIQFNPIDDRYFISGSLDAKVRIWSIPDHQVVDWSDLHEMVTAACYTPD 608 >ref|XP_009378485.1| PREDICTED: WD repeat-containing protein 44 [Pyrus x bretschneideri] Length = 875 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/51 (74%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP++ VVDW DLHEMVT CYT D Sbjct: 555 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPD 605 >ref|XP_008452481.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Cucumis melo] Length = 886 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N +D R +ISGSLDAKV IWSIP++ VVDW+DLHEMVT CYT D Sbjct: 558 VTCIQFNPIDDRYFISGSLDAKVRIWSIPDHQVVDWSDLHEMVTAACYTPD 608 >ref|XP_008452480.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Cucumis melo] Length = 918 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N +D R +ISGSLDAKV IWSIP++ VVDW+DLHEMVT CYT D Sbjct: 590 VTCIQFNPIDDRYFISGSLDAKVRIWSIPDHQVVDWSDLHEMVTAACYTPD 640 >ref|XP_008366762.1| PREDICTED: WD repeat-containing protein 44-like [Malus domestica] Length = 877 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/51 (74%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP++ VVDW DLHEMVT CYT D Sbjct: 556 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPD 606 >ref|XP_007021341.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] gi|508720969|gb|EOY12866.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 937 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/51 (74%), Positives = 41/51 (80%) Frame = +1 Query: 121 VTCIQLNTVDGRNYISGSLDAKVHIWSIPEYLVVDWTDLHEMVTTTCYTHD 273 VTCIQ N VD R +ISGSLDAKV IWSIP++ VVDW DLHEMVT CYT D Sbjct: 610 VTCIQFNPVDDRYFISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPD 660