BLASTX nr result
ID: Ophiopogon21_contig00006946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00006946 (384 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008798060.1| PREDICTED: U-box domain-containing protein 4... 57 4e-06 ref|XP_010913476.1| PREDICTED: U-box domain-containing protein 3... 57 5e-06 >ref|XP_008798060.1| PREDICTED: U-box domain-containing protein 41-like [Phoenix dactylifera] Length = 557 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/58 (48%), Positives = 40/58 (68%) Frame = +1 Query: 208 DSEAEAILVKLKNPQISFKESGLVTLRHSARESSQRRISLCTPSLLSALVPMILSTNP 381 D E I +KL +P++S +E+ L LR + RES +RI+LCTP LL++L PM+LS P Sbjct: 219 DCLEEEISIKLMDPEVSEQEAALAALRQATRESRDQRIALCTPRLLASLRPMLLSRCP 276 >ref|XP_010913476.1| PREDICTED: U-box domain-containing protein 39-like [Elaeis guineensis] Length = 558 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = +1 Query: 208 DSEAEAILVKLKNPQISFKESGLVTLRHSARESSQRRISLCTPSLLSALVPMILSTNP 381 D E I +KL N ++S +E+ L LR + RES RRI+LCTP LL+ L PM+LS P Sbjct: 221 DCLEEEISIKLMNSEVSEQEAALAALRQATRESRDRRIALCTPRLLATLRPMLLSRWP 278