BLASTX nr result
ID: Ophiopogon21_contig00006812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00006812 (403 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010907302.1| PREDICTED: protein TIFY 5A-like [Elaeis guin... 56 9e-06 >ref|XP_010907302.1| PREDICTED: protein TIFY 5A-like [Elaeis guineensis] Length = 153 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 291 PQLINPGLSMKRSLQRFLEKRKMRMDAASPYH 196 PQL+N GLSMKRSLQRFL+KRK RM+AASPY+ Sbjct: 111 PQLLNQGLSMKRSLQRFLQKRKARMNAASPYN 142