BLASTX nr result
ID: Ophiopogon21_contig00006743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00006743 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010927319.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 >ref|XP_010927319.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Elaeis guineensis] gi|743804971|ref|XP_010927320.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Elaeis guineensis] gi|743804975|ref|XP_010927321.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Elaeis guineensis] Length = 727 Score = 62.8 bits (151), Expect = 1e-07 Identities = 36/82 (43%), Positives = 46/82 (56%) Frame = -1 Query: 248 NSHPDTHPLIQTFTQLCLRGPLDAAMAALCSLQSHNLPISVVDPAAFXXXXXXXXXXXSP 69 N P HPLI++F+ LCL GPL AAMAA+ SLQ+H L DP ++ S Sbjct: 118 NPTPPHHPLIESFSYLCLHGPLPAAMAAMASLQAHGLR---ADPISYSQLIKLCLNRGSI 174 Query: 68 ESGRRVHRHLLSYTHRAPTMFL 3 + GR +H HL S H P +FL Sbjct: 175 DDGRLIHHHLSSDGH-CPKLFL 195