BLASTX nr result
ID: Ophiopogon21_contig00006323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00006323 (371 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997... 75 1e-11 ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610... 74 3e-11 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 74 4e-11 ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104... 74 4e-11 ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595... 74 6e-11 ref|XP_009394699.1| PREDICTED: uncharacterized protein LOC103980... 74 6e-11 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 73 7e-11 ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703... 73 1e-10 ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179... 72 1e-10 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 72 1e-10 ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968... 72 2e-10 gb|KCW56704.1| hypothetical protein EUGRSUZ_I02397, partial [Euc... 72 2e-10 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 72 2e-10 ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973... 72 2e-10 ref|XP_008792809.1| PREDICTED: uncharacterized protein LOC103709... 72 2e-10 ref|XP_011653152.1| PREDICTED: uncharacterized protein LOC105435... 71 3e-10 ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247... 71 3e-10 ref|XP_014504913.1| PREDICTED: uncharacterized protein LOC106764... 71 4e-10 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 71 4e-10 ref|XP_010664724.1| PREDICTED: uncharacterized protein LOC104882... 71 4e-10 >ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997494 [Musa acuminata subsp. malaccensis] Length = 41 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSPILSEILLS FMINS L+ RSHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610579 [Nelumbo nucifera] Length = 41 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSPILSEILLS FMINS L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] Length = 41 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP+LSEILLS FMINS L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104584 [Nicotiana tomentosiformis] Length = 45 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 139 FQLMSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 F++MSP++SE+LLS F INS L R+HLVQSFSVVFLYWFYVFS Sbjct: 2 FEIMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595623 [Nelumbo nucifera] Length = 41 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSPI+SEILLS FMINS+L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPIVSEILLSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009394699.1| PREDICTED: uncharacterized protein LOC103980141 [Musa acuminata subsp. malaccensis] Length = 57 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSPILSEILLS MINS ++HR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGCMINSTIRHRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] gi|944057566|gb|KQJ93156.1| hypothetical protein BRADI_3g02990 [Brachypodium distachyon] Length = 41 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP++SEILLS FMINS L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703760 [Phoenix dactylifera] gi|672144149|ref|XP_008795970.1| PREDICTED: uncharacterized protein LOC103711555 [Phoenix dactylifera] Length = 41 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSPILSEILLS FMI+S+L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMISSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179060 [Sesamum indicum] Length = 41 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP+LSEILLS F +NS+L RSHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFTVNSSLHRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] Length = 45 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -2 Query: 139 FQLMSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 F +MSP++SE+LLS F INS L R+HLVQSFSVVFLYWFYVFS Sbjct: 2 FGIMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968797 [Musa acuminata subsp. malaccensis] Length = 41 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSPILSEILL FMINS L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >gb|KCW56704.1| hypothetical protein EUGRSUZ_I02397, partial [Eucalyptus grandis] Length = 72 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 133 LMSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 + SP+LSEILL FM+NSAL+ R+HLVQSFSVVFLYWFYVFS Sbjct: 31 MTSPVLSEILLLHFMVNSALRRRTHLVQSFSVVFLYWFYVFS 72 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|593795374|ref|XP_007160725.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|731312172|ref|XP_010672909.1| PREDICTED: uncharacterized protein LOC104889396 [Beta vulgaris subsp. vulgaris] gi|747073329|ref|XP_011083620.1| PREDICTED: uncharacterized protein LOC105166091 [Sesamum indicum] gi|802595010|ref|XP_012071924.1| PREDICTED: uncharacterized protein LOC105633842 [Jatropha curcas] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|870869972|gb|KMT20717.1| hypothetical protein BVRB_1g006920 [Beta vulgaris subsp. vulgaris] gi|947066007|gb|KRH15150.1| hypothetical protein GLYMA_14G071500 [Glycine max] Length = 41 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP+LSEIL S FMINS+L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973592 [Musa acuminata subsp. malaccensis] Length = 41 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP+LSEIL S FMINS L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_008792809.1| PREDICTED: uncharacterized protein LOC103709303 [Phoenix dactylifera] Length = 92 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSPILSEI LS FMINS +H +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEIFLSGFMINSTFRHPTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011653152.1| PREDICTED: uncharacterized protein LOC105435181 [Cucumis sativus] Length = 41 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP+LSEILLS F+INSAL+ R+HLVQSFSVVFLYWFY FS Sbjct: 1 MSPVLSEILLSGFIINSALRRRTHLVQSFSVVFLYWFYNFS 41 >ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247207 [Vitis vinifera] Length = 41 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP+LSE+L S FMINS L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEVLRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_014504913.1| PREDICTED: uncharacterized protein LOC106764966 [Vigna radiata var. radiata] Length = 41 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP+LSEIL S FMINS+L+ R+HLVQSFSV+FLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVLFLYWFYVFS 41 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 M+P+L EILLS FMINS L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010664724.1| PREDICTED: uncharacterized protein LOC104882564 [Vitis vinifera] Length = 41 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -2 Query: 130 MSPILSEILLSRFMINSALQHRSHLVQSFSVVFLYWFYVFS 8 MSP++SEIL S FMINS+L+ R+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLKRRTHLVQSFSVVFLYWFYVFS 41