BLASTX nr result
ID: Ophiopogon21_contig00004656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00004656 (1076 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447442.1| hypothetical protein SORBIDRAFT_06g001130 [S... 60 4e-06 >ref|XP_002447442.1| hypothetical protein SORBIDRAFT_06g001130 [Sorghum bicolor] gi|241938625|gb|EES11770.1| hypothetical protein SORBIDRAFT_06g001130 [Sorghum bicolor] Length = 425 Score = 59.7 bits (143), Expect = 4e-06 Identities = 26/37 (70%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +3 Query: 969 VWES-QTSGLMFQGVPRPSVPKHNKPRRVDLYYSSWC 1076 +W S +T + +GVPRPSVP+HNKPRRVDLYYSSWC Sbjct: 238 IWASGKTFYCVTKGVPRPSVPRHNKPRRVDLYYSSWC 274