BLASTX nr result
ID: Ophiopogon21_contig00003695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00003695 (624 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010924548.1| PREDICTED: glycosyltransferase-like At2g4145... 58 5e-06 >ref|XP_010924548.1| PREDICTED: glycosyltransferase-like At2g41451 [Elaeis guineensis] Length = 529 Score = 57.8 bits (138), Expect = 5e-06 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = -3 Query: 550 EDPQRKTSSVLPSSIAGELANTQKIASSKESHATNRKILEFSDIFEKALPPMSPPGLDD 374 E Q K SS LP+ NT + A KES+A+ RKILE + E A+PP+SPPGLDD Sbjct: 470 EGLQNKNSSALPNLSTAASKNTMRGAGGKESYASARKILETAVFTENAIPPISPPGLDD 528