BLASTX nr result
ID: Ophiopogon21_contig00003328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00003328 (423 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ99593.1| ferritin [Lycoris aurea] 122 1e-25 ref|XP_008792167.1| PREDICTED: ferritin-3, chloroplastic-like [P... 121 2e-25 gb|ABJ99592.1| ferritin [Lycoris aurea] 120 3e-25 ref|XP_010922613.1| PREDICTED: ferritin-4, chloroplastic [Elaeis... 120 5e-25 ref|XP_012454531.1| PREDICTED: ferritin-3, chloroplastic-like [G... 119 9e-25 ref|XP_008811159.1| PREDICTED: ferritin-3, chloroplastic-like [P... 119 9e-25 ref|XP_003579051.1| PREDICTED: ferritin-1, chloroplastic [Brachy... 117 4e-24 gb|ACS32300.1| ferritin [Jatropha curcas] 117 4e-24 ref|XP_002526668.1| ferritin, plant, putative [Ricinus communis]... 116 6e-24 ref|XP_002268054.3| PREDICTED: ferritin-4, chloroplastic [Vitis ... 116 8e-24 emb|CBI18116.3| unnamed protein product [Vitis vinifera] 116 8e-24 gb|ACJ05648.1| ferritin 1B, partial [Triticum aestivum] 115 1e-23 gb|ACJ05647.1| ferritin 1B, partial [Triticum aestivum] 115 1e-23 gb|ACJ05645.1| ferritin 1A, partial [Triticum aestivum] gi|21006... 115 1e-23 gb|ACJ05644.1| ferritin 1A, partial [Triticum aestivum] 115 1e-23 gb|ACJ05643.1| ferritin 1A [Triticum aestivum] gi|210061131|gb|A... 115 1e-23 gb|AAW68440.1| ferritin [Triticum aestivum] 115 1e-23 gb|EMT08096.1| Ferritin-1, chloroplastic [Aegilops tauschii] 115 1e-23 gb|EMS58657.1| Ferritin-1, chloroplastic [Triticum urartu] 115 1e-23 gb|ABR26678.1| ferritin 1 [Hordeum vulgare] 115 1e-23 >gb|ABJ99593.1| ferritin [Lycoris aurea] Length = 250 Score = 122 bits (306), Expect = 1e-25 Identities = 58/70 (82%), Positives = 65/70 (92%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLLNLH+VATRCNDPQL +++E E+L EQVEAIKKISEYVAQLRR+GK GHG WHFD Sbjct: 182 TNEKLLNLHAVATRCNDPQLAEFMESEYLNEQVEAIKKISEYVAQLRRVGK-GHGTWHFD 240 Query: 241 QVLLHEGAAA 212 Q+LLHEGAAA Sbjct: 241 QMLLHEGAAA 250 >ref|XP_008792167.1| PREDICTED: ferritin-3, chloroplastic-like [Phoenix dactylifera] Length = 264 Score = 121 bits (303), Expect = 2e-25 Identities = 57/67 (85%), Positives = 62/67 (92%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLLNLHSVA +CNDPQ+ D+VE EFL EQVEAIKKISEYVAQLRR+GK GHGVWHFD Sbjct: 195 TNEKLLNLHSVAVKCNDPQMADFVESEFLGEQVEAIKKISEYVAQLRRVGK-GHGVWHFD 253 Query: 241 QVLLHEG 221 Q+LLHEG Sbjct: 254 QMLLHEG 260 >gb|ABJ99592.1| ferritin [Lycoris aurea] Length = 250 Score = 120 bits (302), Expect = 3e-25 Identities = 57/70 (81%), Positives = 65/70 (92%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLLNLH+VATRCNDPQL +++E E+L EQVEAI+KISEYVAQLRR+GK GHG WHFD Sbjct: 182 TNEKLLNLHAVATRCNDPQLAEFMESEYLNEQVEAIEKISEYVAQLRRVGK-GHGTWHFD 240 Query: 241 QVLLHEGAAA 212 Q+LLHEGAAA Sbjct: 241 QMLLHEGAAA 250 >ref|XP_010922613.1| PREDICTED: ferritin-4, chloroplastic [Elaeis guineensis] Length = 265 Score = 120 bits (300), Expect = 5e-25 Identities = 55/70 (78%), Positives = 63/70 (90%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLLN+H VA RCNDPQ+ D++E +FL EQVEAIKKISEY+AQLRR+GK GHGVWHFD Sbjct: 196 TNEKLLNVHGVAARCNDPQMADFIESDFLGEQVEAIKKISEYIAQLRRVGK-GHGVWHFD 254 Query: 241 QVLLHEGAAA 212 Q+LLHEG AA Sbjct: 255 QMLLHEGDAA 264 >ref|XP_012454531.1| PREDICTED: ferritin-3, chloroplastic-like [Gossypium raimondii] gi|763807434|gb|KJB74372.1| hypothetical protein B456_011G290900 [Gossypium raimondii] Length = 250 Score = 119 bits (298), Expect = 9e-25 Identities = 58/70 (82%), Positives = 65/70 (92%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLLNLH+VA R +D QLTD++EGEFLAEQVE+IKKISEYVAQLRR+GK GHGVWHFD Sbjct: 182 TNEKLLNLHNVAERNHDSQLTDFIEGEFLAEQVESIKKISEYVAQLRRVGK-GHGVWHFD 240 Query: 241 QVLLHEGAAA 212 Q+LLHEGA A Sbjct: 241 QMLLHEGAVA 250 >ref|XP_008811159.1| PREDICTED: ferritin-3, chloroplastic-like [Phoenix dactylifera] Length = 261 Score = 119 bits (298), Expect = 9e-25 Identities = 57/70 (81%), Positives = 63/70 (90%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLLN+HSVA RCNDPQ+ +Y+E EFL EQVEAIKKISEYVAQLRR+GK GHGVWHFD Sbjct: 192 TNEKLLNVHSVAERCNDPQMMEYIESEFLGEQVEAIKKISEYVAQLRRVGK-GHGVWHFD 250 Query: 241 QVLLHEGAAA 212 Q+LLHE AA Sbjct: 251 QMLLHEEDAA 260 >ref|XP_003579051.1| PREDICTED: ferritin-1, chloroplastic [Brachypodium distachyon] gi|944056989|gb|KQJ92627.1| hypothetical protein BRADI_4g44870 [Brachypodium distachyon] Length = 249 Score = 117 bits (292), Expect = 4e-24 Identities = 57/67 (85%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQVEAIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 184 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVEAIKKISEYVSQLRRVGK-GHGVWHFDQ 242 Query: 238 VLLHEGA 218 +LL E A Sbjct: 243 MLLEEAA 249 >gb|ACS32300.1| ferritin [Jatropha curcas] Length = 257 Score = 117 bits (292), Expect = 4e-24 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLLNLHSVA++ ND QL+D+VE EFLAEQV+AIKKISEYVAQLRR+GK GHGVWHFD Sbjct: 187 TNEKLLNLHSVASKSNDVQLSDFVESEFLAEQVDAIKKISEYVAQLRRVGK-GHGVWHFD 245 Query: 241 QVLLHEGAA 215 Q+LLHEG A Sbjct: 246 QMLLHEGEA 254 >ref|XP_002526668.1| ferritin, plant, putative [Ricinus communis] gi|223533968|gb|EEF35690.1| ferritin, plant, putative [Ricinus communis] Length = 253 Score = 116 bits (291), Expect = 6e-24 Identities = 57/70 (81%), Positives = 62/70 (88%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLLNLHSVA + NDPQL D++E EFL EQVE IKKISEYVAQLRR+GK GHGVWHFD Sbjct: 185 TNEKLLNLHSVADKNNDPQLADFIESEFLVEQVEDIKKISEYVAQLRRVGK-GHGVWHFD 243 Query: 241 QVLLHEGAAA 212 Q+LLHEG AA Sbjct: 244 QMLLHEGDAA 253 >ref|XP_002268054.3| PREDICTED: ferritin-4, chloroplastic [Vitis vinifera] Length = 333 Score = 116 bits (290), Expect = 8e-24 Identities = 58/70 (82%), Positives = 62/70 (88%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLL LHSVA R NDPQLTD++E EFL EQVEAIKKISEYVAQLRR+GK GHGVWHFD Sbjct: 265 TNEKLLLLHSVADRNNDPQLTDFIESEFLTEQVEAIKKISEYVAQLRRVGK-GHGVWHFD 323 Query: 241 QVLLHEGAAA 212 Q+LL EG AA Sbjct: 324 QMLLEEGGAA 333 >emb|CBI18116.3| unnamed protein product [Vitis vinifera] Length = 261 Score = 116 bits (290), Expect = 8e-24 Identities = 58/70 (82%), Positives = 62/70 (88%) Frame = -3 Query: 421 TNEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFD 242 TNEKLL LHSVA R NDPQLTD++E EFL EQVEAIKKISEYVAQLRR+GK GHGVWHFD Sbjct: 193 TNEKLLLLHSVADRNNDPQLTDFIESEFLTEQVEAIKKISEYVAQLRRVGK-GHGVWHFD 251 Query: 241 QVLLHEGAAA 212 Q+LL EG AA Sbjct: 252 QMLLEEGGAA 261 >gb|ACJ05648.1| ferritin 1B, partial [Triticum aestivum] Length = 78 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 13 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 71 Query: 238 VLLHEGA 218 +LL E A Sbjct: 72 MLLEEAA 78 >gb|ACJ05647.1| ferritin 1B, partial [Triticum aestivum] Length = 197 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 132 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 190 Query: 238 VLLHEGA 218 +LL E A Sbjct: 191 MLLEEAA 197 >gb|ACJ05645.1| ferritin 1A, partial [Triticum aestivum] gi|210061141|gb|ACJ05651.1| ferritin 1C, partial [Triticum aestivum] Length = 197 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 132 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 190 Query: 238 VLLHEGA 218 +LL E A Sbjct: 191 MLLEEAA 197 >gb|ACJ05644.1| ferritin 1A, partial [Triticum aestivum] Length = 78 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 13 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 71 Query: 238 VLLHEGA 218 +LL E A Sbjct: 72 MLLEEAA 78 >gb|ACJ05643.1| ferritin 1A [Triticum aestivum] gi|210061131|gb|ACJ05646.1| ferritin 1A [Triticum aestivum] gi|210061139|gb|ACJ05650.1| ferritin 1C [Triticum aestivum] Length = 255 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 190 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 248 Query: 238 VLLHEGA 218 +LL E A Sbjct: 249 MLLEEAA 255 >gb|AAW68440.1| ferritin [Triticum aestivum] Length = 256 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 191 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 249 Query: 238 VLLHEGA 218 +LL E A Sbjct: 250 MLLEEAA 256 >gb|EMT08096.1| Ferritin-1, chloroplastic [Aegilops tauschii] Length = 207 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 142 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 200 Query: 238 VLLHEGA 218 +LL E A Sbjct: 201 MLLEEAA 207 >gb|EMS58657.1| Ferritin-1, chloroplastic [Triticum urartu] Length = 207 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 142 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 200 Query: 238 VLLHEGA 218 +LL E A Sbjct: 201 MLLEEAA 207 >gb|ABR26678.1| ferritin 1 [Hordeum vulgare] Length = 254 Score = 115 bits (289), Expect = 1e-23 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -3 Query: 418 NEKLLNLHSVATRCNDPQLTDYVEGEFLAEQVEAIKKISEYVAQLRRIGKGGHGVWHFDQ 239 NEKL NLHSVATRCNDPQLTD+VE EFL EQV+AIKKISEYV+QLRR+GK GHGVWHFDQ Sbjct: 189 NEKLHNLHSVATRCNDPQLTDFVESEFLQEQVDAIKKISEYVSQLRRVGK-GHGVWHFDQ 247 Query: 238 VLLHEGA 218 +LL E A Sbjct: 248 MLLEEAA 254