BLASTX nr result
ID: Ophiopogon21_contig00003257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00003257 (767 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008795242.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-08 ref|XP_010912626.1| PREDICTED: ATP-dependent zinc metalloproteas... 64 1e-07 >ref|XP_008795242.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Phoenix dactylifera] Length = 857 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 765 IWDKRILEIRDEVSMQIEEDTEKPQLLMADHFL 667 IWDKRI EI+DEVSMQ+EEDTEKPQLLMADHFL Sbjct: 825 IWDKRIQEIKDEVSMQVEEDTEKPQLLMADHFL 857 >ref|XP_010912626.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Elaeis guineensis] Length = 877 Score = 63.9 bits (154), Expect = 1e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 765 IWDKRILEIRDEVSMQIEEDTEKPQLLMADHFL 667 IWDKRI EI+DEVSMQIEEDT KPQLLMADHFL Sbjct: 845 IWDKRIEEIKDEVSMQIEEDTAKPQLLMADHFL 877