BLASTX nr result
ID: Ophiopogon21_contig00000224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00000224 (707 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009141970.1| photosystem I reaction center subunit IX (ch... 88 6e-15 ref|YP_006503709.1| photosystem I subunit IX (chloroplast) [Eryc... 88 6e-15 ref|YP_009048594.1| photosystem I reaction center subunit IX [Pa... 88 6e-15 gb|AEX95830.1| photosystem I subunit IX (chloroplast) [Crinum as... 88 6e-15 gb|AEX95828.1| photosystem I subunit IX (chloroplast) [Tulbaghia... 88 6e-15 ref|YP_009026457.1| photosystem I subunit IX (chloroplast) [Dend... 88 6e-15 gb|AEX95819.1| photosystem I subunit IX (chloroplast) [Anemarrhe... 88 6e-15 gb|AKP95033.1| photosystem I subunit IX (chloroplast) [Anoectoch... 87 8e-15 ref|YP_009179971.1| photosystem I reaction center subunit IX (ch... 87 1e-14 ref|YP_009176528.1| photosystem I subunit IX (chloroplast) [Sobr... 87 1e-14 ref|YP_009093820.1| photosystem I subunit IX (chloroplast) [Luzu... 87 1e-14 ref|YP_009048219.1| photosystem I reaction center subunit IX (ch... 87 1e-14 ref|YP_009171999.1| photosystem I subunit IX (chloroplast) [Mach... 87 1e-14 ref|YP_009129551.1| photosystem I reaction center subunit IX (ch... 86 2e-14 ref|YP_009130062.1| photosystem I subunit IX (chloroplast) [Camp... 86 2e-14 ref|YP_009122607.1| photosystem I subunit IX (chloroplast) [Masd... 86 2e-14 ref|YP_009109297.1| photosystem I subunit IX (plastid) [Corallor... 86 2e-14 ref|YP_009109080.1| photosystem I subunit IX (plastid) [Corallor... 86 2e-14 ref|YP_009045586.1| photosystem I subunit IX (chloroplast) [Cypr... 86 2e-14 ref|YP_358598.1| PSI reaction centre subunit IX [Phalaenopsis ap... 86 2e-14 >ref|YP_009141970.1| photosystem I reaction center subunit IX (chloroplast) [Heloniopsis tubiflora] gi|705244349|gb|AIW56524.1| photosystem I reaction center subunit IX (chloroplast) [Heloniopsis tubiflora] Length = 46 Score = 87.8 bits (216), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_006503709.1| photosystem I subunit IX (chloroplast) [Erycina pusilla] gi|511943397|ref|YP_008081670.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium sinense] gi|511943510|ref|YP_008081826.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium tracyanum] gi|520850547|ref|YP_008081592.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium aloifolium] gi|724137224|ref|YP_009109017.1| photosystem I subunit IX (plastid) [Corallorhiza macrantha] gi|725676331|ref|YP_009109224.1| photosystem I subunit IX (plastid) [Corallorhiza wisteriana] gi|745999041|ref|YP_009108945.1| photosystem I subunit IX (plastid) [Corallorhiza bulbosa] gi|788366099|ref|YP_009123452.1| photosystem I reaction center subunit IX (chloroplast) [Cattleya crispata] gi|918021053|ref|YP_009163420.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium faberi] gi|944543206|ref|YP_009175216.1| photosystem I reaction center subunit IX (plastid) [Oncidium sphacelatum] gi|339431321|gb|AEJ72515.1| photosystem I subunit IX (chloroplast) [Erycina pusilla] gi|482662068|gb|AGK25297.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium aloifolium] gi|482662147|gb|AGK25375.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium sinense] gi|482662305|gb|AGK25531.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium tortisepalum] gi|482662463|gb|AGK25687.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium tracyanum] gi|694174800|gb|AIS67475.1| photosystem I reaction center subunit IX (plastid) [Oncidium sphacelatum] gi|704001105|gb|AIW51224.1| photosystem I subunit IX (plastid) [Corallorhiza bulbosa] gi|704001237|gb|AIW51354.1| photosystem I subunit IX (plastid) [Corallorhiza maculata var. mexicana] gi|704001371|gb|AIW51486.1| photosystem I subunit IX (plastid) [Corallorhiza macrantha] gi|704001581|gb|AIW51693.1| photosystem I subunit IX (plastid) [Corallorhiza wisteriana] gi|756762333|gb|AJM70424.1| photosystem I reaction center subunit IX (chloroplast) [Cattleya crispata] gi|913021759|gb|AKU70920.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium faberi] gi|948550078|gb|ALM87856.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium goeringii] gi|948550156|gb|ALM87933.1| photosystem I reaction center subunit IX (chloroplast) [Cymbidium ensifolium] Length = 44 Score = 87.8 bits (216), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009048594.1| photosystem I reaction center subunit IX [Paris verticillata] gi|712911717|ref|YP_009092702.1| photosystem I reaction center subunit IX [Eustrephus latifolius] gi|810932452|ref|YP_009129364.1| photosystem I reaction center subunit IX (chloroplast) [Cypripedium formosanum] gi|810932559|ref|YP_009129451.1| photosystem I reaction center subunit IX (chloroplast) [Goodyera fumata] gi|827045551|ref|YP_009141883.1| photosystem I reaction center subunit IX (chloroplast) [Xerophyllum tenax] gi|827046290|ref|YP_009142591.1| photosystem I reaction center subunit IX (plastid) [Trillium cuneatum] gi|836614333|ref|YP_009144794.1| photosystem I subunit IX (chloroplast) [Elleanthus sodiroi] gi|836642906|ref|YP_009143909.1| photosystem I subunit IX (plastid) [Cypripedium japonicum] gi|836643863|ref|YP_009145280.1| photosystem I reaction center subunit IX (plastid) [Trillium decumbens] gi|918020800|ref|YP_009163215.1| photosystem I reaction center subunit IX (plastid) [Trillium maculatum] gi|918020889|ref|YP_009163298.1| photosystem I reaction center subunit IX (plastid) [Trillium tschonoskii] gi|372484384|gb|AEX95833.1| photosystem I subunit IX (chloroplast) [Aphyllanthes monspeliensis] gi|372484404|gb|AEX95843.1| photosystem I subunit IX (chloroplast) [Bowiea volubilis] gi|372484406|gb|AEX95844.1| photosystem I subunit IX (chloroplast) [Drimia altissima] gi|372484408|gb|AEX95845.1| photosystem I subunit IX (chloroplast) [Ledebouria cordifolia] gi|372484410|gb|AEX95846.1| photosystem I subunit IX (chloroplast) [Ornithogalum tenuifolium] gi|372484412|gb|AEX95847.1| photosystem I subunit IX (chloroplast) [Oziroe biflora] gi|372484418|gb|AEX95850.1| photosystem I subunit IX (chloroplast) [Trichopetalum plumosum] gi|372484436|gb|AEX95859.1| photosystem I subunit IX (chloroplast) [Androstephium coeruleum] gi|372484438|gb|AEX95860.1| photosystem I subunit IX (chloroplast) [Brodiaea californica] gi|372484440|gb|AEX95861.1| photosystem I subunit IX (chloroplast) [Dichelostemma capitatum] gi|372484442|gb|AEX95862.1| photosystem I subunit IX (chloroplast) [Dichelostemma congestum] gi|372484444|gb|AEX95863.1| photosystem I subunit IX (chloroplast) [Dichelostemma ida-maia] gi|372484446|gb|AEX95864.1| photosystem I subunit IX (chloroplast) [Triteleia hyacinthina] gi|372484450|gb|AEX95866.1| photosystem I subunit IX (chloroplast) [Xeronema callistemon] gi|374974389|gb|AFA27290.1| photosystem I subunit IX (plastid) [Albuca kirkii] gi|374974391|gb|AFA27291.1| photosystem I subunit IX, partial (plastid) [Apostasia wallichii] gi|584297201|gb|AHI87547.1| photosystem I reaction center subunit IX (chloroplast) [Chionographis japonica] gi|618625604|gb|AHX80470.1| photosystem I reaction center subunit IX [Paris verticillata] gi|632812730|gb|AHZ42960.1| photosystem I reaction center subunit IX (chloroplast) [Cypripedium formosanum] gi|632812818|gb|AHZ43047.1| photosystem I reaction center subunit IX (chloroplast) [Goodyera fumata] gi|648933356|gb|AIC37294.1| photosystem I subunit IX [Cypripedium japonicum] gi|690196766|gb|AIR12538.1| photosystem I reaction center subunit IX [Eustrephus latifolius] gi|705244242|gb|AIW56437.1| photosystem I reaction center subunit IX (chloroplast) [Xerophyllum tenax] gi|821608277|gb|AKH59853.1| photosystem I reaction center subunit IX (plastid) [Trillium cuneatum] gi|827346195|gb|AKJ77401.1| photosystem I subunit IX (chloroplast) [Elleanthus sodiroi] gi|828348699|gb|AKK32160.1| photosystem I reaction center subunit IX (plastid) [Trillium decumbens] gi|910266184|gb|AKU36928.1| photosystem I reaction center subunit IX (plastid) [Trillium maculatum] gi|910266266|gb|AKU37009.1| photosystem I reaction center subunit IX (plastid) [Trillium tschonoskii] Length = 44 Score = 87.8 bits (216), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >gb|AEX95830.1| photosystem I subunit IX (chloroplast) [Crinum asiaticum] gi|372484416|gb|AEX95849.1| photosystem I subunit IX (chloroplast) [Cordyline australis] gi|372484432|gb|AEX95857.1| photosystem I subunit IX (chloroplast) [Sansevieria trifasciata] Length = 45 Score = 87.8 bits (216), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >gb|AEX95828.1| photosystem I subunit IX (chloroplast) [Tulbaghia violacea] Length = 44 Score = 87.8 bits (216), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009026457.1| photosystem I subunit IX (chloroplast) [Dendrobium catenatum] gi|695101522|ref|YP_009057171.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|697964909|ref|YP_009059539.1| photosystem I subunit IX [Iris gatesii] gi|712911819|ref|YP_009092787.1| photosystem I reaction center subunit IX [Bomarea edulis] gi|806636709|ref|YP_009129635.1| photosystem I reaction center subunit IX (chloroplast) [Paphiopedilum niveum] gi|814072119|ref|YP_009129872.1| photosystem I reaction center subunit IX (chloroplast) [Paphiopedilum armeniacum] gi|910355994|ref|YP_009161847.1| photosystem I subunit IX (chloroplast) [Dendrobium strongylanthum] gi|944541412|ref|YP_009175290.1| photosystem I reaction center subunit IX (chloroplast) [Phragmipedium longifolium] gi|953244977|ref|YP_009180128.1| photosystem I subunit IX (chloroplast) [Polygonatum cyrtonema] gi|953245054|ref|YP_009180208.1| photosystem I subunit IX (chloroplast) [Dendrobium huoshanense] gi|372484368|gb|AEX95825.1| photosystem I subunit IX (chloroplast) [Allium fistulosum] gi|372484370|gb|AEX95826.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|372484386|gb|AEX95834.1| photosystem I subunit IX (chloroplast) [Asparagus officinalis] gi|372484388|gb|AEX95835.1| photosystem I subunit IX (chloroplast) [Asparagus asparagoides] gi|372484390|gb|AEX95836.1| photosystem I subunit IX (chloroplast) [Hemiphylacus alatostylus] gi|372484392|gb|AEX95837.1| photosystem I subunit IX (chloroplast) [Aloe vera] gi|372484396|gb|AEX95839.1| photosystem I subunit IX (chloroplast) [Haworthia cymbiformis] gi|372484398|gb|AEX95840.1| photosystem I subunit IX (chloroplast) [Kniphofia linearifolia] gi|372484400|gb|AEX95841.1| photosystem I subunit IX (chloroplast) [Doryanthes palmeri] gi|372484420|gb|AEX95851.1| photosystem I subunit IX (chloroplast) [Beaucarnea hookeri] gi|372484422|gb|AEX95852.1| photosystem I subunit IX (chloroplast) [Dasylirion wheeleri] gi|372484424|gb|AEX95853.1| photosystem I subunit IX (chloroplast) [Eriospermum cervicorne] gi|372484426|gb|AEX95854.1| photosystem I subunit IX (chloroplast) [Liriope spicata] gi|372484428|gb|AEX95855.1| photosystem I subunit IX (chloroplast) [Ophiopogon japonicus] gi|372484430|gb|AEX95856.1| photosystem I subunit IX (chloroplast) [Ruscus aculeatus] gi|372484434|gb|AEX95858.1| photosystem I subunit IX (chloroplast) [Maianthemum stellatum] gi|372484448|gb|AEX95865.1| photosystem I subunit IX (chloroplast) [Xanthorrhoea preissii] gi|374974393|gb|AFA27292.1| photosystem I subunit IX (plastid) [Asparagus officinalis] gi|374974423|gb|AFA27307.1| photosystem I subunit IX (plastid) [Iris virginica] gi|374974437|gb|AFA27314.1| photosystem I subunit IX, partial (plastid) [Neoastelia spectabilis] gi|374974441|gb|AFA27316.1| photosystem I subunit IX, partial (plastid) [Nolina atopocarpa] gi|507474339|gb|AGM48215.1| photosystem I subunit IX (chloroplast) [Dendrobium catenatum] gi|567767881|gb|AHC94607.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|567767963|gb|AHC94688.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|655167112|gb|AIC82626.1| photosystem I reaction center subunit IX (chloroplast) [Paphiopedilum niveum] gi|657406534|gb|AID52251.1| photosystem I reaction center subunit IX (chloroplast) [Paphiopedilum armeniacum] gi|685161422|gb|AIN79066.1| photosystem I subunit IX [Iris gatesii] gi|690196862|gb|AIR12623.1| photosystem I reaction center subunit IX (plastid) [Bomarea edulis] gi|691192167|gb|AIR76426.1| photosystem I subunit IX (chloroplast) [Dendrobium catenatum] gi|694174875|gb|AIS67549.1| photosystem I reaction center subunit IX (chloroplast) [Phragmipedium longifolium] gi|744671165|gb|AJC99075.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|744671273|gb|AJC99161.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|744671386|gb|AJC99247.1| photosystem I subunit IX (chloroplast) [Allium cepa] gi|827505303|gb|AKJ83580.1| PSI reaction center subunit IX (chloroplast) [Alocasia macrorrhizos] gi|906346854|gb|AKS28645.1| photosystem I subunit IX (chloroplast) [Dendrobium strongylanthum] gi|933501831|gb|ALG65725.1| photosystem I subunit IX (chloroplast) [Anoectochilus roxburghii] gi|937957711|gb|ALJ02092.1| photosystem I subunit IX (chloroplast) [Paphiopedilum armeniacum] gi|944543344|gb|ALL96534.1| photosystem I subunit IX (chloroplast) [Polygonatum cyrtonema] gi|944543421|gb|ALL96610.1| photosystem I subunit IX (chloroplast) [Dendrobium huoshanense] gi|948549997|gb|ALM87776.1| photosystem I subunit IX (chloroplast) [Polygonatum verticillatum] gi|952109225|gb|ALN98156.1| photosystem I subunit IX (chloroplast) [Dendrobium chrysotoxum] Length = 42 Score = 87.8 bits (216), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >gb|AEX95819.1| photosystem I subunit IX (chloroplast) [Anemarrhena asphodeloides] gi|372484372|gb|AEX95827.1| photosystem I subunit IX (chloroplast) [Gilliesia graminea] gi|372484376|gb|AEX95829.1| photosystem I subunit IX (chloroplast) [Amaryllis belladonna] gi|372484380|gb|AEX95831.1| photosystem I subunit IX (chloroplast) [Eucharis x grandiflora] gi|372484382|gb|AEX95832.1| photosystem I subunit IX (chloroplast) [Scadoxus cinnabarinus] Length = 44 Score = 87.8 bits (216), Expect = 6e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >gb|AKP95033.1| photosystem I subunit IX (chloroplast) [Anoectochilus roxburghii] Length = 44 Score = 87.4 bits (215), Expect = 8e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAP+LTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPILTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009179971.1| photosystem I reaction center subunit IX (chloroplast) [Bletilla striata] gi|943496717|gb|ALL53058.1| photosystem I reaction center subunit IX (chloroplast) [Bletilla striata] Length = 44 Score = 87.0 bits (214), Expect = 1e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRD+KTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDLKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009176528.1| photosystem I subunit IX (chloroplast) [Sobralia aff. bouchei HTK-2015] gi|944543123|ref|YP_009175133.1| photosystem I reaction center subunit IX (chloroplast) [Sobralia callosa] gi|694174717|gb|AIS67393.1| photosystem I reaction center subunit IX (chloroplast) [Sobralia callosa] gi|937957671|gb|ALJ02053.1| photosystem I subunit IX (chloroplast) [Sobralia aff. bouchei HTK-2015] Length = 44 Score = 87.0 bits (214), Expect = 1e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRD+KTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDLKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009093820.1| photosystem I subunit IX (chloroplast) [Luzuriaga radicans] gi|695277435|gb|AIT16012.1| photosystem I subunit IX (chloroplast) [Luzuriaga radicans] Length = 42 Score = 87.0 bits (214), Expect = 1e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRD+KTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDLKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009048219.1| photosystem I reaction center subunit IX (chloroplast) [Calanthe triplicata] gi|573015309|gb|AHF71890.1| photosystem I reaction center subunit IX (chloroplast) [Calanthe triplicata] Length = 44 Score = 87.0 bits (214), Expect = 1e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPV+TTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVITTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009171999.1| photosystem I subunit IX (chloroplast) [Machilus yunnanensis] gi|938340058|ref|YP_009172079.1| photosystem I subunit IX (chloroplast) [Machilus balansae] gi|913021854|gb|AKU70994.1| photosystem I subunit IX (chloroplast) [Cinnamomum micranthum f. kanehirae] gi|929982342|gb|ALF35704.1| photosystem I subunit IX (chloroplast) [Machilus yunnanensis] gi|929982423|gb|ALF35784.1| photosystem I subunit IX (chloroplast) [Machilus balansae] Length = 44 Score = 86.7 bits (213), Expect = 1e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDAL+FPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALTFPFF 42 >ref|YP_009129551.1| photosystem I reaction center subunit IX (chloroplast) [Habenaria pantlingiana] gi|655167037|gb|AIC82552.1| photosystem I reaction center subunit IX (chloroplast) [Habenaria pantlingiana] Length = 52 Score = 86.3 bits (212), Expect = 2e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 M+DIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MQDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009130062.1| photosystem I subunit IX (chloroplast) [Campynema lineare] gi|768803730|gb|AJV88531.1| photosystem I subunit IX (chloroplast) [Campynema lineare] gi|873467195|gb|AKP49364.1| photosystem I reaction center subunit IX (chloroplast) [Campynema lineare] Length = 46 Score = 86.3 bits (212), Expect = 2e-14 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSL GLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLGGLLIEINRLFPDALSFPFF 42 >ref|YP_009122607.1| photosystem I subunit IX (chloroplast) [Masdevallia coccinea] gi|806636797|ref|YP_009129713.1| photosystem I reaction center subunit IX (chloroplast) [Masdevallia picturata] gi|657406380|gb|AID52099.1| photosystem I reaction center subunit IX (chloroplast) [Masdevallia picturata] gi|755161323|gb|AJJ48575.1| photosystem I subunit IX (chloroplast) [Masdevallia coccinea] Length = 44 Score = 86.3 bits (212), Expect = 2e-14 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINR FPDALSFPFF Sbjct: 1 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRFFPDALSFPFF 42 >ref|YP_009109297.1| photosystem I subunit IX (plastid) [Corallorhiza odontorhiza] gi|704001655|gb|AIW51766.1| photosystem I subunit IX (plastid) [Corallorhiza odontorhiza] Length = 44 Score = 86.3 bits (212), Expect = 2e-14 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLST PVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTVPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009109080.1| photosystem I subunit IX (plastid) [Corallorhiza mertensiana] gi|704001170|gb|AIW51288.1| photosystem I subunit IX (plastid) [Corallorhiza maculata var. maculata] gi|704001301|gb|AIW51417.1| photosystem I subunit IX (plastid) [Corallorhiza maculata var. occidentalis] gi|704001435|gb|AIW51549.1| photosystem I subunit IX (plastid) [Corallorhiza mertensiana] Length = 44 Score = 86.3 bits (212), Expect = 2e-14 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 MRDIKTYLSTAP LTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MRDIKTYLSTAPALTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_009045586.1| photosystem I subunit IX (chloroplast) [Cypripedium macranthos] gi|69217666|gb|AAZ04098.1| photosystem I subunit IX [Yucca schidigera] gi|372484358|gb|AEX95820.1| photosystem I subunit IX (chloroplast) [Camassia scilloides] gi|372484362|gb|AEX95822.1| photosystem I subunit IX (chloroplast) [Hosta ventricosa] gi|372484366|gb|AEX95824.1| photosystem I subunit IX (chloroplast) [Polianthes sp. Pires 2011-05] gi|374974419|gb|AFA27305.1| photosystem I subunit IX, partial (plastid) [Hesperaloe parviflora] gi|374974421|gb|AFA27306.1| photosystem I subunit IX, partial (plastid) [Hosta ventricosa] gi|578888886|gb|AHI16769.1| photosystem I subunit IX (chloroplast) (chloroplast) [Cypripedium macranthos] Length = 44 Score = 86.3 bits (212), Expect = 2e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 M+DIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MQDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42 >ref|YP_358598.1| PSI reaction centre subunit IX [Phalaenopsis aphrodite subsp. formosana] gi|385153470|ref|YP_006073285.1| photosystem I subunit IX (chloroplast) [Phalaenopsis equestris] gi|723457542|ref|YP_009107580.1| photosystem I subunit IX (chloroplast) [Phalaenopsis hybrid cultivar] gi|122213424|sp|Q3BAM0.1|PSAJ_PHAAO RecName: Full=Photosystem I reaction center subunit IX; AltName: Full=PSI-J gi|58802800|gb|AAW82520.1| photosystem I subunit IX [Phalaenopsis aphrodite subsp. formosana] gi|329668835|gb|AEB96282.1| photosystem I subunit IX (chloroplast) [Phalaenopsis equestris] gi|699975253|gb|AIU44788.1| photosystem I subunit IX (chloroplast) [Phalaenopsis hybrid cultivar] Length = 44 Score = 86.3 bits (212), Expect = 2e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 486 MRDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 361 M+DIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF Sbjct: 1 MQDIKTYLSTAPVLTTLWFGSLAGLLIEINRLFPDALSFPFF 42