BLASTX nr result
ID: Mentha29_contig00046579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00046579 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007155714.1| hypothetical protein PHAVU_003G225200g [Phas... 137 1e-30 emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 108 3e-26 ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 89 1e-21 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 82 2e-16 ref|XP_006401949.1| hypothetical protein EUTSA_v10015926mg [Eutr... 79 7e-13 ref|XP_002535828.1| conserved hypothetical protein [Ricinus comm... 60 8e-08 ref|XP_002517741.1| conserved hypothetical protein [Ricinus comm... 57 7e-07 >ref|XP_007155714.1| hypothetical protein PHAVU_003G225200g [Phaseolus vulgaris] gi|561029068|gb|ESW27708.1| hypothetical protein PHAVU_003G225200g [Phaseolus vulgaris] Length = 73 Score = 137 bits (346), Expect = 1e-30 Identities = 61/65 (93%), Positives = 62/65 (95%) Frame = +1 Query: 43 FFHNKTWTIIPTLGSLRVYVHPWSGTVSFRFIPCSRYPNSRKCVHTPQTDLTRNPFSRTN 222 FFHNKTWTIIPTLGSLR+YVHPW TVSFRFIPCSRYPNSRKCVHTPQT LTRNPFSRTN Sbjct: 6 FFHNKTWTIIPTLGSLRLYVHPWLDTVSFRFIPCSRYPNSRKCVHTPQTYLTRNPFSRTN 65 Query: 223 TTPTH 237 TTPTH Sbjct: 66 TTPTH 70 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 108 bits (269), Expect(2) = 3e-26 Identities = 53/60 (88%), Positives = 54/60 (90%) Frame = +2 Query: 2 DRGSNPPAVAGRLFSFTIRPGRLSLPSVAYEFTSIPGRVQFPFDLSLVAVTRIRASVSTP 181 DRG+NPPAVAGRLF FTIRPGRLSLPSVAYEFTSIPGRVQFPFD SLVAVTRIRA P Sbjct: 149 DRGTNPPAVAGRLFCFTIRPGRLSLPSVAYEFTSIPGRVQFPFDFSLVAVTRIRARAPLP 208 Score = 36.2 bits (82), Expect(2) = 3e-26 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 253 APLPAYPYKTRVGGS 297 APLPAYPYKTRVGGS Sbjct: 205 APLPAYPYKTRVGGS 219 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 88.6 bits (218), Expect(2) = 1e-21 Identities = 44/60 (73%), Positives = 47/60 (78%) Frame = +2 Query: 11 SNPPAVAGRLFSFTIRPGRLSLPSVAYEFTSIPGRVQFPFDLSLVAVTRIRASVSTPPKL 190 + P G LF FTIRPGRLSLPSVA +F S+P RVQFPFD SLVAVTRIR SVSTPP L Sbjct: 72 NQPVCCGGALFFFTIRPGRLSLPSVACKFMSVPSRVQFPFDFSLVAVTRIRTSVSTPPNL 131 Score = 40.0 bits (92), Expect(2) = 1e-21 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +3 Query: 180 PPN*LDEESILANKHNPYT 236 PPN LDEESIL NKHNPYT Sbjct: 128 PPNLLDEESILVNKHNPYT 146 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 82.4 bits (202), Expect(2) = 2e-16 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 210 EWIPRQVSLGGVDTLARIRVTATRDKSKGNCTRPGMDVNS 91 EWIPRQVSLGGVDTLARIRVTATR+KSKGNCT+PGMDVNS Sbjct: 203 EWIPRQVSLGGVDTLARIRVTATREKSKGNCTQPGMDVNS 242 Score = 28.9 bits (63), Expect(2) = 2e-16 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 295 TRLLGSCMDMQE 260 TRLLGSCMDMQE Sbjct: 177 TRLLGSCMDMQE 188 >ref|XP_006401949.1| hypothetical protein EUTSA_v10015926mg [Eutrema salsugineum] gi|557103039|gb|ESQ43402.1| hypothetical protein EUTSA_v10015926mg [Eutrema salsugineum] Length = 181 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 210 EWIPRQVSLGGVDTLARIRVTATRDKSKGNCTRPGMDVNS 91 EWIPRQV LGGVDTLA+I+VTATR+KSKGNCTRPGMDVNS Sbjct: 142 EWIPRQVCLGGVDTLAQIQVTATREKSKGNCTRPGMDVNS 181 >ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis] gi|255608154|ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis] gi|223510119|gb|EEF23533.1| conserved hypothetical protein [Ricinus communis] gi|223521805|gb|EEF26555.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 59.7 bits (143), Expect(2) = 8e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 183 GGVDTLARIRVTATRDKSKGNCTRPGMD 100 GGVDTLARIRVTATR+KSKGNCTRPGMD Sbjct: 9 GGVDTLARIRVTATREKSKGNCTRPGMD 36 Score = 22.3 bits (46), Expect(2) = 8e-08 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -3 Query: 208 MDSSSSQFGG 179 MDSSSS+FGG Sbjct: 1 MDSSSSKFGG 10 >ref|XP_002517741.1| conserved hypothetical protein [Ricinus communis] gi|223543139|gb|EEF44673.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 57.0 bits (136), Expect(2) = 7e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 183 GGVDTLARIRVTATRDKSKGNCTRPGMD 100 GG+DTLA+IRVTATR+KSKGNCTRPGMD Sbjct: 9 GGMDTLAQIRVTATREKSKGNCTRPGMD 36 Score = 21.9 bits (45), Expect(2) = 7e-07 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 43 KKPPRHSRRVASSV 2 K P HSRRV SS+ Sbjct: 37 KIAPHHSRRVGSSI 50