BLASTX nr result
ID: Mentha29_contig00046517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00046517 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74507.1| hypothetical protein M569_00224, partial [Genlise... 61 1e-07 >gb|EPS74507.1| hypothetical protein M569_00224, partial [Genlisea aurea] Length = 208 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 11 VFNSFFFQSMPIGVPKVPFRSPGEEDASWVDV 106 VF+SF FQ MPIGVPKVPFR PGEEDA+WVDV Sbjct: 4 VFSSFLFQLMPIGVPKVPFRIPGEEDATWVDV 35