BLASTX nr result
ID: Mentha29_contig00046154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00046154 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35492.1| hypothetical protein MIMGU_mgv1a023380mg, partial... 68 2e-09 gb|EPS71349.1| hypothetical protein M569_03408 [Genlisea aurea] 65 1e-08 >gb|EYU35492.1| hypothetical protein MIMGU_mgv1a023380mg, partial [Mimulus guttatus] Length = 517 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 189 SSLKKPAVAISPTDLLHFLKSRLRHHPTLSHLDFHLFRY 73 S LK VAI+P +LLHF KSRLRHHPTLSHLDFHLFRY Sbjct: 90 SFLKNGIVAITPKELLHFFKSRLRHHPTLSHLDFHLFRY 128 >gb|EPS71349.1| hypothetical protein M569_03408 [Genlisea aurea] Length = 481 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 192 ESSLKKPAVAISPTDLLHFLKSRLRHHPTLSHLDFHLFRY 73 E+ + K V I+P +LL FLKSRLRHHPTLSHLDFHLFRY Sbjct: 56 ETYVNKSPVTITPQELLRFLKSRLRHHPTLSHLDFHLFRY 95