BLASTX nr result
ID: Mentha29_contig00045365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045365 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P11113.1|SR4_PHYPO RecName: Full=Spherulin-4; Flags: Precurso... 62 1e-07 >sp|P11113.1|SR4_PHYPO RecName: Full=Spherulin-4; Flags: Precursor gi|3232|emb|CAA32212.1| spherulin 4 precursor [Physarum polycephalum] Length = 332 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 254 KDKFVAIIHTSSSSSMATYMDQLKSKNYFGWVYITDGAGGCCTYNTLTSYYTQ 96 K KF I H++SS SM+ ++ + S G VY+TDGA GCCTYNTLTSY +Q Sbjct: 271 KYKFSGIAHSTSSGSMSGIINTMVSVLAMGLVYVTDGAAGCCTYNTLTSYLSQ 323