BLASTX nr result
ID: Mentha29_contig00045326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045326 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27598.1| hypothetical protein MIMGU_mgv1a025623mg, partial... 109 3e-22 gb|EPS59304.1| hypothetical protein M569_15504, partial [Genlise... 99 8e-19 ref|XP_002518826.1| conserved hypothetical protein [Ricinus comm... 97 2e-18 ref|XP_006378614.1| hypothetical protein POPTR_0010s18220g [Popu... 96 7e-18 ref|XP_004509999.1| PREDICTED: protein strawberry notch-like iso... 95 1e-17 ref|XP_006389897.1| hypothetical protein EUTSA_v10018021mg [Eutr... 94 2e-17 gb|EXB51234.1| Protein strawberry notch [Morus notabilis] 94 2e-17 ref|XP_007022750.1| RING/FYVE/PHD zinc finger superfamily protei... 94 2e-17 ref|XP_007022749.1| RING/FYVE/PHD zinc finger superfamily protei... 94 2e-17 ref|XP_004293788.1| PREDICTED: protein strawberry notch-like [Fr... 94 2e-17 ref|XP_007133457.1| hypothetical protein PHAVU_011G180100g [Phas... 94 3e-17 ref|XP_006300941.1| hypothetical protein CARUB_v10021321mg [Caps... 94 3e-17 gb|AAC17076.1| Similar to D. melanogaster sno gene gb|U95760. ES... 94 3e-17 ref|NP_178053.4| protein EMBRYO DEFECTIVE 1135 [Arabidopsis thal... 94 3e-17 ref|XP_002889240.1| EMB1135 [Arabidopsis lyrata subsp. lyrata] g... 94 3e-17 ref|XP_006352591.1| PREDICTED: protein strawberry notch-like [So... 93 3e-17 ref|XP_004248286.1| PREDICTED: protein strawberry notch-like [So... 93 3e-17 ref|XP_002312224.2| hypothetical protein POPTR_0008s08070g [Popu... 93 4e-17 ref|XP_003634816.1| PREDICTED: protein strawberry notch-like [Vi... 92 8e-17 ref|XP_006585721.1| PREDICTED: protein strawberry notch-like iso... 92 1e-16 >gb|EYU27598.1| hypothetical protein MIMGU_mgv1a025623mg, partial [Mimulus guttatus] Length = 152 Score = 109 bits (273), Expect = 3e-22 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -2 Query: 267 QAQAQRTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 QAQ QR APAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHI+LAVDLSKI+Q Sbjct: 82 QAQ-QRNAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHINLAVDLSKIAQ 136 >gb|EPS59304.1| hypothetical protein M569_15504, partial [Genlisea aurea] Length = 262 Score = 98.6 bits (244), Expect = 8e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -2 Query: 255 QRTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDL 115 + APAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCH+SLA+DL Sbjct: 61 RNNAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHVSLAIDL 107 >ref|XP_002518826.1| conserved hypothetical protein [Ricinus communis] gi|223541999|gb|EEF43544.1| conserved hypothetical protein [Ricinus communis] Length = 1281 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = -2 Query: 267 QAQAQRTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKI 106 Q Q Q+ PAHGIDPTKIQLPC NCKA+LNVPHGLSRF+CPQC + LAVDLSK+ Sbjct: 79 QQQQQQQVPAHGIDPTKIQLPCVNCKALLNVPHGLSRFSCPQCFVDLAVDLSKV 132 >ref|XP_006378614.1| hypothetical protein POPTR_0010s18220g [Populus trichocarpa] gi|550330064|gb|ERP56411.1| hypothetical protein POPTR_0010s18220g [Populus trichocarpa] Length = 326 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -2 Query: 258 AQRTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 +Q PAHG+DPTK+QLPCANCKAILNVPHGL+RF CPQC I LAVDLSKI Q Sbjct: 83 SQLQTPAHGVDPTKMQLPCANCKAILNVPHGLARFQCPQCFIDLAVDLSKIKQ 135 >ref|XP_004509999.1| PREDICTED: protein strawberry notch-like isoform X1 [Cicer arietinum] gi|502155230|ref|XP_004510000.1| PREDICTED: protein strawberry notch-like isoform X2 [Cicer arietinum] Length = 1257 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -2 Query: 243 PAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 PAHGIDPTKIQLPCA+CKAILNVPHGLSRF+CPQC + LAVDLSK+ Q Sbjct: 88 PAHGIDPTKIQLPCASCKAILNVPHGLSRFSCPQCKVDLAVDLSKVKQ 135 >ref|XP_006389897.1| hypothetical protein EUTSA_v10018021mg [Eutrema salsugineum] gi|557086331|gb|ESQ27183.1| hypothetical protein EUTSA_v10018021mg [Eutrema salsugineum] Length = 1294 Score = 94.4 bits (233), Expect = 2e-17 Identities = 39/54 (72%), Positives = 49/54 (90%) Frame = -2 Query: 261 QAQRTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 Q + PAHGIDPTK+QLPCANC+AILNVPHGL+RF+CPQCH+ LAVD+SK+++ Sbjct: 99 QPRPPVPAHGIDPTKMQLPCANCQAILNVPHGLTRFSCPQCHVELAVDVSKLNR 152 >gb|EXB51234.1| Protein strawberry notch [Morus notabilis] Length = 874 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -2 Query: 243 PAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKI 106 PAHGIDPTKIQLPCANCKAILNVPHGL+RFNCPQC + LAVD+SK+ Sbjct: 106 PAHGIDPTKIQLPCANCKAILNVPHGLTRFNCPQCSVDLAVDVSKL 151 >ref|XP_007022750.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2, partial [Theobroma cacao] gi|508722378|gb|EOY14275.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2, partial [Theobroma cacao] Length = 1268 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -2 Query: 252 RTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 ++ PAHGIDPTKIQLPCANCKAILNVPHGL+RF+CPQC + LAVDL+K+ Q Sbjct: 76 QSVPAHGIDPTKIQLPCANCKAILNVPHGLARFSCPQCGVDLAVDLNKMKQ 126 >ref|XP_007022749.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma cacao] gi|508722377|gb|EOY14274.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma cacao] Length = 1255 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -2 Query: 252 RTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 ++ PAHGIDPTKIQLPCANCKAILNVPHGL+RF+CPQC + LAVDL+K+ Q Sbjct: 76 QSVPAHGIDPTKIQLPCANCKAILNVPHGLARFSCPQCGVDLAVDLNKMKQ 126 >ref|XP_004293788.1| PREDICTED: protein strawberry notch-like [Fragaria vesca subsp. vesca] Length = 1253 Score = 94.0 bits (232), Expect = 2e-17 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -2 Query: 240 AHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 AHG+DPTKIQLPCANCKAILNVPHGLSRF CPQCH+ LAVD+SK+ + Sbjct: 85 AHGVDPTKIQLPCANCKAILNVPHGLSRFQCPQCHVDLAVDVSKLKE 131 >ref|XP_007133457.1| hypothetical protein PHAVU_011G180100g [Phaseolus vulgaris] gi|561006457|gb|ESW05451.1| hypothetical protein PHAVU_011G180100g [Phaseolus vulgaris] Length = 1265 Score = 93.6 bits (231), Expect = 3e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -2 Query: 246 APAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 APAHGIDPTKIQLPCA+CKAILNVPHGL+RF CPQC++ LAVD+SK+ Q Sbjct: 94 APAHGIDPTKIQLPCASCKAILNVPHGLARFACPQCNVDLAVDVSKVKQ 142 >ref|XP_006300941.1| hypothetical protein CARUB_v10021321mg [Capsella rubella] gi|482569651|gb|EOA33839.1| hypothetical protein CARUB_v10021321mg [Capsella rubella] Length = 1333 Score = 93.6 bits (231), Expect = 3e-17 Identities = 38/48 (79%), Positives = 47/48 (97%) Frame = -2 Query: 243 PAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 PAHGIDPTK+QLPCANC+AILNVPHGL+RF+CPQCH+ LAVD+SK+++ Sbjct: 105 PAHGIDPTKMQLPCANCQAILNVPHGLTRFSCPQCHVELAVDVSKLNR 152 >gb|AAC17076.1| Similar to D. melanogaster sno gene gb|U95760. EST gb|N97148 and gb|Z26221 come from this gene [Arabidopsis thaliana] Length = 1257 Score = 93.6 bits (231), Expect = 3e-17 Identities = 38/48 (79%), Positives = 47/48 (97%) Frame = -2 Query: 243 PAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 PAHGIDPTK+QLPCANC+AILNVPHGL+RF+CPQCH+ LAVD+SK+++ Sbjct: 104 PAHGIDPTKMQLPCANCQAILNVPHGLTRFSCPQCHVELAVDVSKLNR 151 >ref|NP_178053.4| protein EMBRYO DEFECTIVE 1135 [Arabidopsis thaliana] gi|332198112|gb|AEE36233.1| RING/FYVE/PHD zinc finger domain-containing protein [Arabidopsis thaliana] Length = 1295 Score = 93.6 bits (231), Expect = 3e-17 Identities = 38/48 (79%), Positives = 47/48 (97%) Frame = -2 Query: 243 PAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 PAHGIDPTK+QLPCANC+AILNVPHGL+RF+CPQCH+ LAVD+SK+++ Sbjct: 104 PAHGIDPTKMQLPCANCQAILNVPHGLTRFSCPQCHVELAVDVSKLNR 151 >ref|XP_002889240.1| EMB1135 [Arabidopsis lyrata subsp. lyrata] gi|297335081|gb|EFH65499.1| EMB1135 [Arabidopsis lyrata subsp. lyrata] Length = 1299 Score = 93.6 bits (231), Expect = 3e-17 Identities = 38/48 (79%), Positives = 47/48 (97%) Frame = -2 Query: 243 PAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 PAHGIDPTK+QLPCANC+AILNVPHGL+RF+CPQCH+ LAVD+SK+++ Sbjct: 108 PAHGIDPTKMQLPCANCQAILNVPHGLTRFSCPQCHVELAVDVSKLNR 155 >ref|XP_006352591.1| PREDICTED: protein strawberry notch-like [Solanum tuberosum] Length = 1258 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -2 Query: 261 QAQRTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 Q + +A AHGIDPTKIQLPCA+CKAILNVPHGLSRF+CPQC I LAVD+SKI Q Sbjct: 69 QQRSSALAHGIDPTKIQLPCAHCKAILNVPHGLSRFSCPQCGIDLAVDVSKIRQ 122 >ref|XP_004248286.1| PREDICTED: protein strawberry notch-like [Solanum lycopersicum] Length = 1258 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -2 Query: 261 QAQRTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 Q + +A AHGIDPTKIQLPCA+CKAILNVPHGLSRF+CPQC I LAVD+SKI Q Sbjct: 69 QQRSSALAHGIDPTKIQLPCAHCKAILNVPHGLSRFSCPQCGIDLAVDVSKIRQ 122 >ref|XP_002312224.2| hypothetical protein POPTR_0008s08070g [Populus trichocarpa] gi|550332647|gb|EEE89591.2| hypothetical protein POPTR_0008s08070g [Populus trichocarpa] Length = 1282 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -2 Query: 258 AQRTAPAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 +Q+ PA+GIDP+K+QLPCANCKAILNVPHGL+RF CPQC + LAVDLSKI Q Sbjct: 81 SQQQTPAYGIDPSKMQLPCANCKAILNVPHGLARFQCPQCFVDLAVDLSKIKQ 133 >ref|XP_003634816.1| PREDICTED: protein strawberry notch-like [Vitis vinifera] Length = 1242 Score = 92.0 bits (227), Expect = 8e-17 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -2 Query: 243 PAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 PAHGIDPTKIQLPCA+CKAILNVPHGLSRF CPQC I LAVD+SK+ Q Sbjct: 71 PAHGIDPTKIQLPCAHCKAILNVPHGLSRFACPQCGIDLAVDVSKLKQ 118 >ref|XP_006585721.1| PREDICTED: protein strawberry notch-like isoform X2 [Glycine max] Length = 1007 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -2 Query: 246 APAHGIDPTKIQLPCANCKAILNVPHGLSRFNCPQCHISLAVDLSKISQ 100 APAHGIDPTKIQLPCA+CKAILNVPHGL RF CPQC + LAVD+SK+ Q Sbjct: 91 APAHGIDPTKIQLPCASCKAILNVPHGLPRFACPQCGVDLAVDVSKVKQ 139