BLASTX nr result
ID: Mentha29_contig00045117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045117 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355487.1| PREDICTED: probable trehalose-phosphate phos... 64 3e-08 ref|XP_004245739.1| PREDICTED: probable trehalose-phosphate phos... 64 3e-08 gb|EYU30313.1| hypothetical protein MIMGU_mgv1a007850mg [Mimulus... 57 2e-06 gb|EXB54469.1| Trehalose-phosphate phosphatase [Morus notabilis] 56 6e-06 >ref|XP_006355487.1| PREDICTED: probable trehalose-phosphate phosphatase F-like isoform X1 [Solanum tuberosum] gi|565378075|ref|XP_006355488.1| PREDICTED: probable trehalose-phosphate phosphatase F-like isoform X2 [Solanum tuberosum] Length = 384 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 193 ASPVLTDPAPINKSRLGIHSSMMPCSQSGPSFST 294 ASPVLTDP+P+NKSRLGIHSS+ P SQSGPSFST Sbjct: 8 ASPVLTDPSPLNKSRLGIHSSLFPYSQSGPSFST 41 >ref|XP_004245739.1| PREDICTED: probable trehalose-phosphate phosphatase G-like [Solanum lycopersicum] Length = 386 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 193 ASPVLTDPAPINKSRLGIHSSMMPCSQSGPSFST 294 ASPVLTDP+P+NKSRLGIHSS+ P SQSGPSFST Sbjct: 8 ASPVLTDPSPLNKSRLGIHSSLFPYSQSGPSFST 41 >gb|EYU30313.1| hypothetical protein MIMGU_mgv1a007850mg [Mimulus guttatus] Length = 393 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 193 ASPVLTDPAPINKSRLGIHSSMMPCSQSGPSFST 294 AS +L DP+P+NKSRLGI S+++PCSQSGPSF+T Sbjct: 8 ASSILADPSPMNKSRLGIRSNLLPCSQSGPSFTT 41 >gb|EXB54469.1| Trehalose-phosphate phosphatase [Morus notabilis] Length = 393 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 193 ASPVLTDPAPINKSRLGIHSSMMPCSQSGPSFS 291 +SPVLTDPAP+NKSRLGI S ++P SQ GPSFS Sbjct: 8 SSPVLTDPAPVNKSRLGIPSGLLPYSQQGPSFS 40