BLASTX nr result
ID: Mentha29_contig00044426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044426 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109550.1| hypothetical protein Poptr_cp072 [Populus tr... 74 3e-11 >ref|YP_001109550.1| hypothetical protein Poptr_cp072 [Populus trichocarpa] gi|134093268|ref|YP_001109569.1| hypothetical protein Poptr_cp092 [Populus trichocarpa] gi|133712111|gb|ABO36754.1| conserved hypothetical protein [Populus trichocarpa] gi|133712130|gb|ABO36773.1| conserved hypothetical protein [Populus trichocarpa] Length = 65 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = +3 Query: 72 PSQIAMIRRTSFYTISETQGLTSMDM*NTRVSILAGKGGKQILNLK 209 PSQIAMIR TSFYTISETQGL MDM NT ILAGKGGK+ILNLK Sbjct: 20 PSQIAMIRSTSFYTISETQGLNRMDMENTGFPILAGKGGKRILNLK 65