BLASTX nr result
ID: Mentha29_contig00040909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040909 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37862.1| hypothetical protein MIMGU_mgv1a001175mg [Mimulus... 72 1e-10 ref|XP_007042026.1| ATP binding microtubule motor family protein... 59 5e-07 ref|XP_007201806.1| hypothetical protein PRUPE_ppa001038mg [Prun... 55 8e-06 >gb|EYU37862.1| hypothetical protein MIMGU_mgv1a001175mg [Mimulus guttatus] Length = 872 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 264 IGFSEHGVALKEMFGLSFTPPRMTRRAFSWKNSMSSLL 151 IGFSEHG A+KEMFGLSFTPPR+ RR+F+WKNSMSSLL Sbjct: 835 IGFSEHGQAIKEMFGLSFTPPRIVRRSFTWKNSMSSLL 872 >ref|XP_007042026.1| ATP binding microtubule motor family protein, putative [Theobroma cacao] gi|508705961|gb|EOX97857.1| ATP binding microtubule motor family protein, putative [Theobroma cacao] Length = 965 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 264 IGFSEHGVALKEMFGLSFTPPRMTRRAFSWKNSMSSLL 151 I F E G ALKEMFGLSFTPPR RR++ WKNSM+SLL Sbjct: 928 IRFVEQGRALKEMFGLSFTPPRPRRRSYGWKNSMASLL 965 >ref|XP_007201806.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica] gi|462397206|gb|EMJ03005.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica] Length = 926 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 258 FSEHGVALKEMFGLSFTPPRMTRRAFSWKNSMSSLL 151 F E G ALK MFGLSFTPP+ RR+F WKNSM+SL+ Sbjct: 891 FIEQGHALKGMFGLSFTPPKARRRSFGWKNSMASLI 926